KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_2738Help
Entry
BT9727_2738       CDS       T00179                                 

Gene name
phoB
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00730  Thiamine metabolism
btk00790  Folate biosynthesis
btk01100  Metabolic pathways
btk02020  Two-component system
Module
btk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BT9727_2738 (phoB)
   00790 Folate biosynthesis
    BT9727_2738 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BT9727_2738 (phoB)
Enzymes [BR:btk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BT9727_2738 (phoB)
Exosome [BR:btk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BT9727_2738 (phoB)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:btk00537]
 Enzymes
  BT9727_2738 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase Cu_amine_oxidN1
Motif
Other DBs
NCBI-GeneID: 2857787
NCBI-ProteinID: YP_037062
UniProt: Q6HHB4
Position
complement(2814280..2815953)
Genome map
AA seq 557 aa AA seqDB search
MSELALKMKRLLLVGTITLSMLCTESLMNYHTVEAKVKKVERMPKNVIIMVMDGTSSTAT
TLARLYKGKALALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPSIVSS
PGLKPMKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHVNRNNFEVLAE
QQVYQNIDVVLGGGKAALLPVTNSGIRKDGEDLVKVIQNKGYDFVETKEALLGSKSNKIW
GSFSHNALAFDMDREATTPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDP
IGMISDVLAFDNAVAEALKFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPVSAYI
DPLKKAKMTLEGTINNLKADISNVEEVAKLYGLDNLTYDEKERLKTAKKKIDVGPIFTTL
LSKRANIGFTTGGHTGEDVFLYSYGPQKPYGLIQNTDVAKTLAKAMGFNLEKVTNKLFVE
SESAFKQNDAAVTIDKTDVANPVLIVKRNNVTAQLFVNKNIIRIKNKEYELGSVVVESNG
KVYVPEEAIHLFRKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagttagctttaaagatgaagagattactgttagtaggcacaatcacactaagt
atgttatgtactgaaagtttgatgaattatcatacagtggaagctaaagtgaaaaaagta
gaacggatgcctaaaaatgtaatcataatggttatggacggcacaagttctacagcaact
acattagctcgcttgtataaagggaaagcacttgcattagatgaaattgtaacaggagga
gtgcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcgacggggaataaatcaaattcaggatatgtaggcgtattgccttcaattgtaagttca
cctggcttaaaaccaatgaaagaagaggataagttacgaccagttgccaatgttttagaa
ggtgccaaacgtacggggcgcgcaactggaattgttgctacagctgaaattcagcatgct
actcctgctggattctccgctcatcatgtgaatcgtaacaattttgaagtgctcgcggag
caacaagtatatcaaaatatagatgtcgtattaggcgggggaaaagcagcacttctacct
gtaacaaatagtgggattcgaaaagatggtgaagatttagtaaaagtgattcaaaacaaa
gggtacgactttgttgaaacgaaagaagcattattaggctctaaatctaataaaatttgg
ggctctttctcacataatgctttagcgttcgatatggatcgtgaagcaacaactccagag
caaccaacactctctcaaatgacggaaaaagcaattcaaacgttatcaaaagataaagat
ggcttctttttatttgtggaaggaagtaaaccagactgggcagcccatgtgaatgatcca
attgggatgattagtgatgtgttagcatttgataatgcagttgcagaagcattgaagttt
gcaaaaaaagatggtaatacgatgctaatagccgtagcggaccatggtaacagcggtatt
tctattggcaatatgaatacgacaaaaggatataatactacgccggtctctgcgtacatt
gatcctttgaaaaaagcgaagatgacacttgaagggactatcaataatttgaaagctgat
atatcaaatgtagaagaggtagctaaattatacgggttggacaatttaacttatgatgaa
aaagaaaggttaaaaacggctaaaaagaaaatagatgtaggtccaattttcactacatta
ttgtctaagcgtgcgaacataggcttcacaacaggagggcatacaggtgaggatgtattc
ttatattcatacggtcctcaaaagccatacggtttgattcaaaatacggacgttgcgaag
acgctggcgaaagcgatgggctttaacttagaaaaagtaacaaacaaattatttgtagaa
agtgaatcagcctttaagcagaatgatgcagctgtaacaatagataaaactgatgtagcg
aaccctgtactcatagtaaaacgtaataatgtaacagctcaattatttgttaacaaaaat
ataattcgtattaagaataaagagtatgaattaggaagtgttgttgtagaaagtaatgga
aaggtttacgtaccagaagaagcaattcatctatttagaaaacattctcgttaa

DBGET integrated database retrieval system