KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_3273Help
Entry
BT9727_3273       CDS       T00179                                 

Definition
(RefSeq) zinc-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00010  Glycolysis / Gluconeogenesis
btk00071  Fatty acid degradation
btk00350  Tyrosine metabolism
btk00625  Chloroalkane and chloroalkene degradation
btk00626  Naphthalene degradation
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_3273
  Lipid metabolism
   00071 Fatty acid degradation
    BT9727_3273
  Amino acid metabolism
   00350 Tyrosine metabolism
    BT9727_3273
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BT9727_3273
   00626 Naphthalene degradation
    BT9727_3273
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BT9727_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C CMAS ADH_N_2
Motif
Other DBs
NCBI-GeneID: 2857253
NCBI-ProteinID: YP_037595
UniProt: Q6HFT1
Position
3339683..3340681
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFSGVITKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMHLQKGQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGS
DLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGNIVSVSGIPNA
RFGKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRIIANYIEAGKIKP
VIDRVFPFEDAQKAMEYSEAGRAKGKIIVKIK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgataattgataagtacggaaaagttccaatgcgcatggcagaggtacct
attcctgaaataaatgagcatgaagtgctcgcagaaattcatgcagctagtattaaccca
attgattttaaaatacgcgatggaaaagttaaaatgttactgaaatatgaaatgcctcta
attcttgggaatgacttttccggtgtcatcacgaaggttggatcaaaagtgactcgtttt
aaagtcggcgatgaaatctatgcacgtccaagaaaaaataaaattggtactttcgcggaa
tatatagccattcatgaggatgatatagctttaaaaccgaaaaatttaagttttgaggaa
gcggcgtcgattccacttgttggattaacatcatatcaagcattacatgatatcatgcac
ttacaaaaaggacaaaagattttaattcacgctggatctggtggtgttggtactttcgct
attcagttagcaaaaataatgggtgctaccgttacaacaactgctagtgaagctggttcc
gatttagtcaagtctcttggagcagatcaaattattaattacaaaacagaaaaatttgaa
gaaatactaaaagattatgatgcagtatttgataccattggtggtacaacacttgaaaaa
tcattcgatattataaaaagcggcggcaacattgtttccgtttcaggaataccaaatgct
cgtttcggtaaagaatttggttctggattttttaaaacattcttattttcattagcaagt
aaaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggagatcaattacgtattatcgcaaattatattgaagccggaaaaatcaaacct
gtaatcgatcgcgttttcccttttgaagatgcgcaaaaagcaatggaatattcagaggct
ggcagagcaaaaggaaaaataattgtaaaaataaaataa

DBGET integrated database retrieval system