KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_3548Help
Entry
BT9727_3548       CDS       T00179                                 

Gene name
pnpA
Definition
(RefSeq) polynucleotide phosphorylase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00230  Purine metabolism
btk00240  Pyrimidine metabolism
btk03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BT9727_3548 (pnpA)
   00240 Pyrimidine metabolism
    BT9727_3548 (pnpA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BT9727_3548 (pnpA)
Enzymes [BR:btk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     BT9727_3548 (pnpA)
Messenger RNA biogenesis [BR:btk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BT9727_3548 (pnpA)
Transfer RNA biogenesis [BR:btk03016]
 Prokaryotic Type
  tRNA degradation factors
   BT9727_3548 (pnpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C S1 PNPase KH_1 SPATA25 S1_2 PCB_OB
Motif
Other DBs
NCBI-GeneID: 2854087
NCBI-ProteinID: YP_037868
UniProt: Q6HF08
Position
complement(3641129..3643267)
Genome map
AA seq 712 aa AA seqDB search
MSQEKQVFSIDLAGRQLTVETGQLAKQANGAVLVRYGDTAVLSTATASKEAKNVDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFADGFRNEVQVVSIVMSV
DQDCSSEMAAMLGSSLALSISDIPFEGPIAGATVGRINGEFVINPTVEQQEQSDIHLVVA
GTKDAINMVEAGADQVPEETMLEAIMFGHDEIKRLIAFQEEIVQAVGKEKSEVKLYEVDA
DLNQAVREMAEKDMHSAIQVHEKHAREDAINEVKKRVIEHYEAQEADADTLGQVNEILYK
IVKEEVRRLITVEKIRPDGRKGDEIRPLASEVGILSRTHGSGLFTRGQTQALSICTLGAL
GDVQILDGLGVEESKRFMHHYNFPSFSVGETRPMRGPGRREIGHGALGERALEPVIPSEK
DFPYTVRLVSEVLESNGSTSQASICGSTLAMMDAGVPLKAPVAGIAMGLVKTGEHYTILS
DIQGMEDHLGDMDFKVAGTAHGVTALQMDIKIDGLSREILEEALQQAKVGRVHILNHMLS
VIAEPRTELSAYAPKIITMTINPDKIRDVIGPSGKQINKIIEETGVKIDIEQDGTVFISS
INQEMNDKAKKIIEDIVREVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERV
GKVEDVVKIGDVITVKVIEIDKQGRVNLSRKVLLKEEQEKEAAKEENKQEQQ
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaaaagcaagtcttctcgatagatttagctggtcgccagctaacagttgaa
acaggtcagcttgcaaagcaagcgaacggagcagtattagtaagatatggcgatacagcg
gttctatctacagcaactgcatcaaaagaagcaaaaaatgtagatttcttcccacttaca
gtaaactatgaagagcgtttatatgcagtcggaaaaattcctggcggtttcattaaacgt
gaaggtcgtccaagtgaaaaagcaattttggcaagtcgtttaatcgaccgtccaattcgt
ccgcttttcgctgatggtttccgtaacgaagtacaagttgtcagcatcgtaatgagcgtt
gatcaagattgttcttctgaaatggcagctatgcttggttcttcattagcgttatcgatt
tcagatattccatttgaaggtccaattgcgggtgcaacagttggtcgtattaacggcgaa
ttcgttatcaacccaacagtagaacagcaagaacaaagtgatattcaccttgttgtagct
ggtacgaaagatgcaattaacatggttgaagcaggagcagatcaagtgcctgaggaaaca
atgttagaagcaattatgtttggtcatgacgaaattaaacgtctaattgcattccaagaa
gagattgtacaagctgtaggtaaagagaaatcagaagtgaaactttatgaagttgacgct
gatcttaaccaagctgtacgtgagatggctgagaaggatatgcattctgcaattcaagta
catgagaaacatgcacgtgaagatgcaattaacgaagtgaaaaagcgtgtaattgagcat
tacgaagcgcaggaagctgacgctgatactttaggacaagtaaatgagattttatataaa
attgtaaaagaagaagtacgtcgtcttattacagttgaaaaaatccgcccagatggccgt
aaaggtgacgaaatccgtccattagcatcagaggttggcattttatctcgtacacacggt
tctggtttgttcactcgtggacaaacacaagcattaagtatttgtacattaggtgcatta
ggcgatgtgcaaattttagacggtcttggtgtagaagaatcaaaacgttttatgcaccat
tacaatttcccatcatttagtgttggtgaaacaagaccgatgcgtggaccaggtcgtcgt
gaaatcggtcacggtgcactaggagaacgtgctcttgaacctgtaattccatctgaaaaa
gacttcccatacacagtacgtcttgtgtctgaagtattagaatcaaatggttctacttca
caagcaagtatttgtggtagtactttagcaatgatggatgctggtgttccacttaaagct
ccagttgcaggtattgcaatggggctagttaaaactggtgagcattacacaattttatct
gatattcaaggtatggaagatcatttaggtgatatggactttaaagtagcaggtacagca
catggtgtaactgcattacaaatggacattaaaatcgatggtctatctcgtgaaatttta
gaagaggcattacaacaagcgaaagttggtcgtgtgcacattctaaatcatatgttatct
gttattgcagagccacgcactgaattatcagcgtacgctccaaagattattacaatgaca
attaacccagataaaatccgtgacgttatcggaccaagcggtaaacaaatcaataaaatt
attgaagaaactggcgttaaaattgacatcgagcaagatggtacagtattcatttcttca
ataaatcaagaaatgaacgacaaagctaagaaaattatcgaagatatcgttcgcgaagta
caagtaggtgaaatctacgaaggaaaagtgaaacgtgttgagaaattcggtgctttcgtt
gaattattcagcggtaaagatggattagttcacatttctgaacttgcacttgagcgtgta
ggtaaagtagaagacgttgtgaaaatcggtgatgtaattacagttaaagttatcgagatc
gacaagcaaggtcgcgtgaatctatctagaaaagtattgctaaaagaagagcaagaaaaa
gaagctgctaaagaagaaaacaaacaagagcagcaataa

DBGET integrated database retrieval system