KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_3631Help
Entry
BT9727_3631       CDS       T00179                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00240  Pyrimidine metabolism
btk00250  Alanine, aspartate and glutamate metabolism
btk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BT9727_3631 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BT9727_3631 (pyrB)
Enzymes [BR:btk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BT9727_3631 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C DUF2002
Motif
Other DBs
NCBI-GeneID: 2855677
NCBI-ProteinID: YP_037951
UniProt: Q6HES5
Position
complement(3730260..3731174)
Genome map
AA seq 304 aa AA seqDB search
MSHLLTMSELSEVEISEILKDAEDFANGKESKTTEQTFVANLFFENSTRTRFSFEVAEKR
LGLDVLNFSADASSVQKGETLYDTIRTLESIGTKAVVIRHEQDRYFDELKDQVNIPILNA
GDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKLGATIYFAS
PEEWKDEDNTFGTYKPLDELVPEVDVMMLLRVQHERHDHYETDIMKEYHEKHGLTVEREK
RMKEGSIIMHPAPVNRDVEIASELVECERSRIFKQMENGVYVRMAVLKRALPNVLGGMKH
ELFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgttaacgatgagtgaattatcggaagtagaaatttcagaaatcctaaaa
gacgcagaagattttgcgaatgggaaagagagcaaaacgacagagcaaacttttgttgca
aacttgttctttgagaatagtacgagaacgagatttagctttgaagttgctgagaagaga
ttaggacttgatgttttaaacttttcagctgatgcatctagcgtacaaaaaggagaaact
ttatacgatacgataagaacactagaatcaatcggaacaaaagcagtggtcatccgccat
gagcaagatcgctacttcgatgaactaaaagatcaggtgaatattccaatcttaaacgct
ggagatggatgtggaaatcatccaacacagtgcctactcgatcttcttaccattaaacaa
gagtttggaagatttgaaggtttgaagattgcgatagtaggagatgttcgtcatagccga
gtagcacgttctaatgcagaagcattaacgaagctgggtgcaacaatttactttgcaagt
ccagaagagtggaaagatgaagacaacacatttggaacatacaaaccattagatgaactt
gttccagaagtggatgtaatgatgttacttcgtgtacaacatgagcgtcatgatcattat
gaaacagacattatgaaagagtatcatgagaaacacggattaacagtggaaagagaaaag
cgtatgaaagaaggaagcattattatgcatccagctcctgtaaaccgagatgttgaaatt
gcaagtgaacttgttgagtgtgagcgttcacgcatatttaaacaaatggaaaatggagtt
tacgtaagaatggctgtactaaaacgcgccttaccaaatgtattaggaggaatgaaacat
gaattatttgtttaa

DBGET integrated database retrieval system