KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_3779
Entry
BT9727_3779       CDS       T00179                                 

Gene name
mtnX
Definition
(RefSeq) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00270  Cysteine and methionine metabolism
btk01100  Metabolic pathways
Module
btk_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:btk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BT9727_3779 (mtnX)
Enzymes [BR:btk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     BT9727_3779 (mtnX)
SSDB
Motif
Pfam: HAD Hydrolase Put_Phosphatase UMPH-1 HAD_2
Other DBs
NCBI-GeneID: 2857191
NCBI-ProteinID: YP_038098
UniProt: Q6HEC8
Position
3873826..3874485
AA seq 219 aa
MSIQVFCDFDGTITNNDNIMSIMEKFAPPEAEEVKNRILSQELSIQEGVSQLFQLIPTNL
HDEIIQFLIETAEIRNGFHEFIQFVNENNISFYVISGGMDFFVYPLLQGLIPKEQIYCNE
TDFSNEYITVNWPHPCDRHCQNHCGLCKSSLIRKLGDTNDFHIVIGDSITDLQAAKQADK
VFARDFLITKCEENHISYTPFETFHDVQTELKHLLEVKL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtattcaagtattttgtgatttcgatggcacgattacaaataatgataacatcatg
tccattatggagaaattcgcaccaccagaagctgaagaagtaaagaatagaattttatca
caagagctatctattcaagaaggtgtttctcaattatttcaattaatacctactaatctg
cacgatgaaattattcaatttttaatagagactgctgaaattcgtaatggttttcatgaa
tttatacaatttgtaaatgaaaacaatatttccttttatgttatatcaggtggaatggat
ttcttcgtctatccactcttacaaggactcattccaaaagagcaaatttactgtaatgaa
acagatttttcaaatgaatacattacggtaaattggcctcatccttgtgatcgtcattgt
caaaatcattgcggattatgtaaatcatcacttatccgtaaattgggtgatacgaatgac
ttccatattgtaattggagattcaattaccgatttacaagctgcgaaacaagcagataaa
gtgttcgctcgtgatttccttattacaaaatgcgaagaaaatcatatttcttatacacca
tttgaaacgtttcacgatgttcaaactgaattaaaacatttgttggaggtgaaattatga

DBGET integrated database retrieval system