KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_4196Help
Entry
BT9727_4196       CDS       T00179                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00860  Porphyrin and chlorophyll metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BT9727_4196 (hemD)
Enzymes [BR:btk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BT9727_4196 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Secretin_N
Motif
Other DBs
NCBI-GeneID: 2855258
NCBI-ProteinID: YP_038513
UniProt: Q6HD63
Position
complement(4260611..4261363)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLITRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIAGQLHSYDW
VIFTSKNGVAFFLDYLRKKLPVTTKIAAVGVKTKLELEKRGYEVDFVPTSFVAEVFAEEF
VKRLSGNECILFPKGNLARDVIPVALREIGVSLDELIVYGTKENVEKKRELIEALEVGKV
DIITFTSPSTVTSFVRLLEGTNWREWTKKCTIACIGPITEKEASLYFPHVIMPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggcaaaacggtattgattacacgtgcccagcaccaagcaaaacaa
atgagtgtagcggtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gagggtatgtctcataggcaaattcaacatatagcagggcagctacattcgtatgactgg
gttatttttacgagtaaaaatggggtagctttttttctagattatttgagaaagaagctc
cccgtaacgactaaaattgctgcagtaggcgtgaaaacaaagttagagttagaaaagcga
ggctatgaagtggacttcgttccaacttcatttgttgcagaagtatttgcagaagagttt
gtaaaaagactaagtggaaacgaatgcattttatttccgaaagggaatttagcaagagat
gtcattccagttgcgcttcgcgaaatcggtgtttctctagatgagctcatcgtatatggt
acgaaagaaaatgtagagaaaaagagagagcttatagaagcgttagaagtagggaaagta
gacattattacatttacgagcccttcaactgttactagttttgttcgtttacttgagggt
acaaactggagagaatggacaaaaaaatgtacaattgcttgtatagggcctattacggaa
aaagaggcgagcctttattttccgcatgttattatgccgaaagagtacactgtagaagca
ttactacaatgcgtttgtgaatctataaaataa

DBGET integrated database retrieval system