KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_4259Help
Entry
BT9727_4259       CDS       T00179                                 

Gene name
phaB
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00071  Fatty acid degradation
btk00362  Benzoate degradation
btk01100  Metabolic pathways
btk01120  Microbial metabolism in diverse environments
btk01212  Fatty acid metabolism
Module
btk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BT9727_4259 (phaB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BT9727_4259 (phaB)
Enzymes [BR:btk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BT9727_4259 (phaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 2856912
NCBI-ProteinID: YP_038575
UniProt: Q6HD01
Position
complement(4321411..4322187)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataacattcgtgttgttgttattcacggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacgactcgtgctgtactagagttattgcaaacaacgaaatcgtctcattat
tatgaaggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtcgcagcatttttagaaaagcgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system