KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_4448Help
Entry
BT9727_4448       CDS       T00179                                 

Gene name
gdh
Definition
(RefSeq) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00030  Pentose phosphate pathway
btk01100  Metabolic pathways
btk01120  Microbial metabolism in diverse environments
btk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BT9727_4448 (gdh)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BT9727_4448 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 DUF1776 Epimerase
Motif
Other DBs
NCBI-GeneID: 2854394
NCBI-ProteinID: YP_038762
UniProt: Q6HCG4
Position
complement(4505417..4506202)
Genome map
AA seq 261 aa AA seqDB search
MYSDLEGKVVVITGSASGLGRAMGVRFAAEKAKVVINYRSRESEANDVLEEIKKVGGEAI
AVKGDVTVESDVVNLIQSAVKEFGTLDVMINNAGIENAVPSHEMPLEDWNKVINTNLTGA
FLGSREAIKYFVEHDIKGSIINMSSVHEKIPWPLFVHYAASKGGMKLMTETLAMEYAPKG
IRVNNIGPGAINTPINAEKFADPKKRADVESMIPMGYIGKPEEIAAVATWLASSEASYVT
GITLFADGGMTLYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgatttagaaggaaaggttgtcgttattacaggatcagcaagtggtcttgga
agagcaatgggagtaaggtttgctgcggagaaagcaaaggtagtgattaattatcgctca
cgtgagtcagaagcgaatgatgtgttagaagaaattaaaaaggtaggcggagaagcgatt
gctgtaaaaggtgatgtgacggttgaatctgatgttgtgaacctcattcaatctgctgtg
aaagagtttggtacgcttgacgttatgattaataatgcagggatagaaaatgcggtaccg
tcgcatgaaatgccgcttgaagattggaataaagtaattaatacaaatttaacaggcgct
tttttaggaagccgtgaagcgattaaatattttgtagaacacgatattaaaggatctatc
attaatatgtcgagtgttcatgagaaaattccgtggccactattcgtgcattatgcagcc
agtaagggcggtatgaaactaatgacagaaacgttagcgatggaatatgcaccaaaaggt
attcgagtaaataatattggaccaggtgcaattaatacgccaatcaatgcagaaaagttt
gctgatcctaaaaaacgtgctgacgtagaaagtatgataccgatgggctacattggaaaa
ccagaagaaattgcagcagtagcaacttggctcgcttcgtcagaggcgagttatgtaact
ggaattacgctatttgcagatggcggaatgacgttatatccatcgtttcaagctggacgt
gggtaa

DBGET integrated database retrieval system