KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_5028Help
Entry
BT9727_5028       CDS       T00179                                 

Gene name
atoB
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00071  Fatty acid degradation
btk00072  Synthesis and degradation of ketone bodies
btk00280  Valine, leucine and isoleucine degradation
btk00310  Lysine degradation
btk00362  Benzoate degradation
btk00380  Tryptophan metabolism
btk00620  Pyruvate metabolism
btk00630  Glyoxylate and dicarboxylate metabolism
btk00640  Propanoate metabolism
btk00650  Butanoate metabolism
btk00900  Terpenoid backbone biosynthesis
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01200  Carbon metabolism
btk01212  Fatty acid metabolism
btk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BT9727_5028 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BT9727_5028 (atoB)
   00640 Propanoate metabolism
    BT9727_5028 (atoB)
   00650 Butanoate metabolism
    BT9727_5028 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    BT9727_5028 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BT9727_5028 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BT9727_5028 (atoB)
   00310 Lysine degradation
    BT9727_5028 (atoB)
   00380 Tryptophan metabolism
    BT9727_5028 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BT9727_5028 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BT9727_5028 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BT9727_5028 (atoB)
Enzymes [BR:btk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BT9727_5028 (atoB)
Exosome [BR:btk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BT9727_5028 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ribosomal_S16
Motif
Other DBs
NCBI-GeneID: 2854043
NCBI-ProteinID: YP_039337
UniProt: Q6HAT9
Position
complement(5078164..5079345)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEERAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKTIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccggttggaaaatttggaggatct
ttaaaagatgtaaaagcaacagaacttggaggaatcgcaattaaagcagcgcttgaaaga
gcgaatgtttcagctagtgatgttgaggaagttatattcggaacggttattcaaggtggg
cagggacaaattccatcgcgccaagcggcacgggctgctggaatcccttgggaagtgcag
acggaaacagtcaataaagtttgtgcatcagggcttcgtgcggttactttagcggatcaa
attattcgtactggcgaccaatcactaattgtagctggcggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatacagaatgggtaacaacgaagtcatt
gatttaaacgttgctgacggtttaacatgtgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaggatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccatcagcgtgcggtttcagcacataaagaaggacgttttgaagaggaaatcgtg
ccagtaacgattccacaaagaaaaggggatcctattgtcgttgcaaaggatgaggcgccg
cgtgaagatacaacaattgaaaagctagcaaaattaaaacctgtatttgataagacagcg
acggtaacagctggtaatgcaccagggctaaacgatggtggcgctgcacttgtattaatg
agcgaagagagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgagaacgccaggttatgcaattaacgcattg
cttgaaaaaacaggcaagacaattgaagacattgatttattcgagattaatgaagcattt
gcagcggtagcaattgcaagtacagaaatcgcaggaattgacccagaaaaattgaatgta
aatggcggcgcagtggcgatgggacatccgattggagcaagcggagcgcgcattatcgtt
acattaatccatgcacttaagcaacgcggcggtggaattggaattgcttcgatttgtagt
ggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system