KEGG   Bacillus thuringiensis Al Hakam: BALH_0448Help
Entry
BALH_0448         CDS       T00429                                 

Gene name
ugtP
Definition
(GenBank) Monogalactosyldiacylglycerol synthase
  KO
K03429  processive 1,2-diacylglycerol beta-glucosyltransferase [EC:2.4.1.315]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00561  Glycerolipid metabolism
btl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BALH_0448 (ugtP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:btl01003]
    BALH_0448 (ugtP)
Enzymes [BR:btl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.315  diglucosyl diacylglycerol synthase (1,6-linking)
     BALH_0448 (ugtP)
Glycosyltransferases [BR:btl01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   BALH_0448 (ugtP)
 Glycan extension
  Glycolipid
   BALH_0448 (ugtP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MGDG_synth Glyco_tran_28_C Glycos_transf_1 Epimerase_2 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ABK83843
UniProt: A0R9F0
Position
508931..510097
Genome map
AA seq 388 aa AA seqDB search
MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGESHPVITDITKYLYLK
SYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKLLLQAEKPDIVINTFPIIAVPEL
KKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKKVMVDIGVPAEQIVETGIPIR
SSFELKINPDIIYNKYQLCKNKKILLIVAGAHGVLGSVKELCQSFMSVPDLQVVVVCGKN
EALKQDLVGVQETNPDALKVFGYVENIDELFRVTSCMITKPGGITLSEAAALQVPVILYK
PVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLQDDMKLLQMKEAMKSIYRPEPADH
IVDTILEENHVEPNHIPIKSPALAQSFT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaaaaccccaaggttttaatattaactgcacattacggtaacggtcatgtgcaa
gtagcgaaaacattagagcaaacatttcgccaaaaagggattaaagatgtaattgtatgc
gatttgttcggagaatcacatccggttataaccgatattacaaaatatttatatttaaaa
agttatacaattggaaaagaattataccgcttgttttattatggcgtagaaaaaatttat
gataaaaaaatagcatcttggtatgcgaattttggaagaaaacgtttgaaattactttta
caagcagagaaaccggatattgtcattaatacctttccgattatagctgtaccagaatta
aaaaagcaaacaggtatttcaattcctgtgtataacgtattaacggatttttgtgtgcac
aaaatatggattcatcgggaagtagatcgttattttgtagcaactgatcacgtaaaaaaa
gttatggttgatatcggtgtgcctgcggagcaaattgttgaaaccggaattccgattcgt
agtagttttgagttaaagatcaatccagacattatatataataaatatcagttatgtaag
aataaaaagattttactcattgtagcaggtgctcatggggtattaggaagtgtaaaagaa
ctatgccaatcatttatgtcagtacctgatttacaagtagttgtcgtttgtgggaaaaat
gaagcattaaaacaggatttggtaggggtacaggaaacaaatcctgatgcattaaaagta
tttggttatgttgaaaatattgatgaactattccgcgttacttcttgtatgattacaaag
ccaggcggtattacgttaagtgaggcggcagcattgcaagtacctgtcattttatataag
cctgttccaggacaagaaaatgaaaatgcgatgtactttgaaagaaaaggagctgcagtt
gtcattcgtgatgatagtgaggtttttgcaaaaacagaggcgttattacaagacgatatg
aagcttcttcaaatgaaagaagcgatgaaaagcatttatcgtccggagccagctgatcat
attgtggatacaattttggaagaaaatcatgtagaaccgaatcatatacctattaaatca
cctgctctcgcacaatcatttacttaa

DBGET integrated database retrieval system