KEGG   Bacillus thuringiensis Al Hakam: BALH_1100Help
Entry
BALH_1100         CDS       T00429                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00260  Glycine, serine and threonine metabolism
btl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01130  Biosynthesis of antibiotics
btl01230  Biosynthesis of amino acids
Module
btl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_1100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BALH_1100
Enzymes [BR:btl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BALH_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABK84457
UniProt: A0RB64
Position
1246729..1247922
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEAFQKELNHYLNTYVGRET
PLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEELEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcgatggaa
gatgaagcatttcaaaaggaattaaatcattatttaaatacgtatgttggaagagaaaca
ccgctttatttcgctgagaatatgacggagtattgcggaggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaacaatacaattggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggggctggacaacacggt
gttgcaacagctacggtatgtgcccttctcggtttagagtgcgtcatctttatgggagaa
gaagatgtgagacgtcaaaaattaaatgtgtttcgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggaccgcatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattgggaatgagacgaagaaacaatat
gaagaattagaagggaagttaccagaagcagtcgttgcttgtattggtggtgggagtaac
gcaatgggaatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggtgttttacacggatcaatgatgtatcttctacaaaatgaagaaggtcaaattcaagaa
gcgcactctatttcagcagggcttgattacccaggtgttggtccagaacatagcttgctc
aaagatattggtcgcgtttcttatcattccattactgatgatgaagcgttagaagcattt
caattattaacgaaaaaagaagggattatcccggcgctagaaagctcgcatgctgttgca
tacgcattgaaattagcgccgcaaatgaaggaagacgaaggacttgtcatttgtttatcc
ggccgtggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system