KEGG   Bacillus thuringiensis Al Hakam: BALH_1534Help
Entry
BALH_1534         CDS       T00429                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00010  Glycolysis / Gluconeogenesis
btl00260  Glycine, serine and threonine metabolism
btl00680  Methane metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01130  Biosynthesis of antibiotics
btl01200  Carbon metabolism
btl01230  Biosynthesis of amino acids
Module
btl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btl_M00002  Glycolysis, core module involving three-carbon compounds
btl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_1534 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BALH_1534 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_1534 (gpm)
Enzymes [BR:btl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BALH_1534 (gpm)
Membrane trafficking [BR:btl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BALH_1534 (gpm)
Exosome [BR:btl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BALH_1534 (gpm)
  Exosomal proteins of melanoma cells
   BALH_1534 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 IQ
Motif
Other DBs
NCBI-ProteinID: ABK84872
UniProt: A0RCC9
Position
1678702..1679277
Genome map
AA seq 191 aa AA seqDB search
MTILYFVRHAHSTYTKEERERPLSEKGHLDAENITHLLKDKHIDVVISSPYKRAIQTVQG
IANIYNISIQIEEDLRERLLSTEPVQDFDDAMEKVWGDWNYAYEGGESNDIAQRRAVICI
QSILRKYKGKNIVIGTHGNIMVLLMNYFDSKYDFQFWKTLHMPDVYKLTFDNNCFSFAER
ILSRDSQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacgatactatatttcgttcgccatgctcattctacatatacaaaagaagaacgggag
cgtcctttatctgaaaaagggcacttagatgcagagaatataacacacttattaaaagat
aaacatattgatgttgtgatttctagcccgtacaaaagagcaattcaaactgtgcaagga
attgcaaatatatataatatatcgatacaaatagaagaagatttacgtgaaagattatta
agtacagagccggtacaggattttgatgatgctatggagaaagtgtggggagattggaat
tatgcatacgaaggcggagaatcaaatgatatagcacaaagacgcgccgtaatatgtata
caaagtatattaagaaaatataaaggtaagaatattgtaataggtacgcatggaaatatt
atggtattactaatgaattattttgattcaaaatatgattttcaattttggaaaactctt
catatgcctgacgtgtataaattaacttttgataataattgtttcagttttgctgaaaga
atactgtctagagattctcagataaataatttgtaa

DBGET integrated database retrieval system