KEGG   Bacillus thuringiensis Al Hakam: BALH_2335Help
Entry
BALH_2335         CDS       T00429                                 

Definition
(GenBank) acetamidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00330  Arginine and proline metabolism
btl00360  Phenylalanine metabolism
btl00380  Tryptophan metabolism
btl00627  Aminobenzoate degradation
btl00643  Styrene degradation
btl01100  Metabolic pathways
btl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BALH_2335
   00360 Phenylalanine metabolism
    BALH_2335
   00380 Tryptophan metabolism
    BALH_2335
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BALH_2335
   00643 Styrene degradation
    BALH_2335
Enzymes [BR:btl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BALH_2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdA_AmdA Ribosomal_S7 Penicillinase_R
Motif
Other DBs
NCBI-ProteinID: ABK85632
UniProt: A0REI9
Position
2505331..2506242
Genome map
AA seq 303 aa AA seqDB search
MYRIHKEHIIYAMSSENKPCMEVEIGSRLIFETYDCFENQIDSEDVAFQELDWNRINPAT
GPVYISDGEPGDILSVTIEKIQIAEQGVLTTGTNLGVMGEELHENTVKIVPIHNKHVLFS
NELQIPINPMIGVIGTAPKEESISCGTPHDHGGNMDCKEIKEGTTLLLPVNVPGALLALG
DLHAAMGDGEIGVSGVEVAGEVTVTVHIIKGKKWPLPMAIQKEKIMTLASEQLLDDAANR
AVRNMVTFLHEELQMSKADATLLLSAAGDLKVCQVVDPLKTARMELSMDYVEKLGFDFSK
ISY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaattcataaagaacatatcatttacgcaatgtcatcagaaaataaaccatgt
atggaagtagaaattgggagtcgccttatatttgaaacatatgattgctttgaaaatcaa
attgattctgaagatgttgcgtttcaagaattagattggaaccgaattaatccggcgact
ggacctgtatatatcagtgatggagagcctggtgacatattatccgtaacgattgaaaag
attcaaattgcagagcaaggtgttttaactacaggtacgaatcttggtgtaatgggtgaa
gagctacatgaaaatacagtgaaaattgtcccaatacataataaacatgttttgttttcg
aatgaactacaaatcccaattaatccaatgatcggtgtaattggaactgctccaaaagaa
gagagtatttcatgtggcacaccgcatgatcacggcgggaatatggactgtaaagagata
aaagaagggacaacattattattacctgtaaatgttcctggtgctctattagcattaggc
gatttacacgcagcgatgggtgacggtgaaattggtgttagtggagtagaagttgctggt
gaggtgacggtaacagttcatattataaaaggaaagaaatggccattaccaatggctatt
caaaaagaaaaaataatgacgcttgcttcagagcaattgctagatgatgcagcgaatcgt
gctgtacgtaatatggtgacatttttacatgaagaattacaaatgtctaaagctgatgcc
acgcttttattatcagctgccggtgatttaaaagtttgtcaagttgtggatccgcttaaa
acggcacgaatggaactaagtatggactatgtggagaagttaggttttgactttagtaaa
atttcatattaa

DBGET integrated database retrieval system