KEGG   Bacillus thuringiensis Al Hakam: BALH_2492Help
Entry
BALH_2492         CDS       T00429                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00010  Glycolysis / Gluconeogenesis
btl00020  Citrate cycle (TCA cycle)
btl00620  Pyruvate metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01130  Biosynthesis of antibiotics
btl01200  Carbon metabolism
Module
btl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_2492
   00020 Citrate cycle (TCA cycle)
    BALH_2492
   00620 Pyruvate metabolism
    BALH_2492
Enzymes [BR:btl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BALH_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ABK85779
UniProt: A0REY6
Position
complement(2655631..2656833)
Genome map
AA seq 400 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKIAKTENLDIKSLLGTGPGGRITKVDVLKALEERVAVPEVLEQEESKVIPVTG
MRKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVV
LALGDHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNVA
QKARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEYVPVYKGKKLK
KGSMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttagggatggcgatgaaagagggtattattacg
agctggaatattaaagcgggtgataatgtggcaaaaggagaattaattgccagtattaac
tcggaaaaaattgaaacggaaatagaagcaccagctgatggaactgttcttgatatagct
gtaagtgaagatgagggggttccacctggcactgtaatttgctacattggtaaaccgaat
gaaaaagtagaggtacatgaaagcacaaaggttgaggaagaactgacagcgagtgaagta
ccacaaaatgtacaacatccagaaccgttagggaaagaagttacgaataaacaaagaatc
aaaatatctcctgtagcgaagaagattgcgaaaactgaaaatcttgatattaaatcatta
cttggtaccggtccaggtggaagaattacaaaggtagatgtattaaaggcgcttgaagaa
agagtagcagttccagaagtacttgaacaagaagaaagtaaagtaattcctgttactggt
atgcggaaagcaatcgcaaaccgtatgcatgcaagcttacaaaatagtgcacaattaaca
ttaacgatgaaagtagatgtgacagatttagttgctttacataaagaaatagcagaagtt
gtacaaaaacggtacgataacaaattaaccattacggatttcgtttctcgagctgttgta
ttagcgcttggggatcataaagaaatgaacagcgcttatatagatgatgcaattcatcaa
tttgaacatgttcatttaggtatggcagtcgcattagaaaaaggattagtcgttccagct
attcgcttcgcaaataatctctcattagtagagttatctaaagagattaagaatgtggca
caaaaggcacgagcaggcaatttaaatagtgatgatatgcaaggaacaacatttacaatt
agtaatttaggaagcttcggtattgaatattttacaccagtattaaatacaccagaaact
ggtattttaggtgtaggtgcaattgaatatgttcctgtatataaaggaaaaaaattaaaa
aaaggaagtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcacca
gcagctgcatttttacgcacaattaaacgctatttagaagaacctgtaacaattctttta
taa

DBGET integrated database retrieval system