KEGG   Bacillus thuringiensis Al Hakam: BALH_2659Help
Entry
BALH_2659         CDS       T00429                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00020  Citrate cycle (TCA cycle)
btl00620  Pyruvate metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01130  Biosynthesis of antibiotics
btl01200  Carbon metabolism
Module
btl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BALH_2659
   00620 Pyruvate metabolism
    BALH_2659
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BALH_2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like Pyr_redox FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABK85941
UniProt: A0RFE8
Position
2822472..2823974
Genome map
AA seq 500 aa AA seqDB search
MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGTGHS
ALCELNYTSEKSDGSIDISKAVKVNEQFQLSRQFWAYLVKSKLIRNPQDFIMPLPHMSLV
QGEKNVEFLKNRFEALSKNPLFQGMEFSDAPETLKKWLPLIMEGRTSNEPMAATKIDSGT
DVNFGALTRMLFDYLQTKNVELNYKHSVENIKRTKNGLWEVKVHDINSGKIEHHTAKFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNQKVVEQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGVKEMGLTKY
LIQQVMLSHEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTDAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLEVLEKCFPSRMVEWEGKIKEMIPSYGISLTENPRLFQ
DLHTSTGRTLGLNEKETVHN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatgcagcaaaaaacagacgttatcttaattggtgcaggaattatgagtgca
acgttaggctcattactaaaagaattagcacctgaatgggaaattaaagtttttgaaaaa
ctcgcaagtgccggggaagaaagctctaacgaatggaataatgcaggtacagggcattct
gcgctatgcgaactgaactatacttccgaaaaatctgacggatctatagatattagtaag
gctgtaaaagtgaatgagcaattccagctttcaagacaattttgggcatatcttgtaaaa
agcaaattaattcgtaatccacaagattttattatgcctctacctcatatgagtttagta
caaggtgaaaaaaatgttgagtttctaaaaaaccgttttgaagcgctttcaaaaaatccg
ctgtttcaaggtatggaattttccgatgctcctgaaacattaaaaaaatggcttccactc
attatggaaggacgtacatctaacgaaccgatggctgcaacgaagattgactctggaaca
gatgttaacttcggtgcattaactcgtatgttgtttgattacttacaaacgaaaaatgtc
gagctaaactacaaacatagtgtcgaaaatattaaacgcacgaagaatggtttgtgggaa
gtgaaagtacacgatataaatagtggtaaaattgagcatcatactgcaaaattcgtcttt
atcggcggcggtggcggtagtctacctctactacaaaagactggcattcctgagtcaaaa
catatcggtggattcccagtaagcggactatttatggtatgtaaaaaccaaaaagttgtc
gagcaacatcatgcgaaagtatacggtaaagctaaggttggcgctccgccaatgtctgtt
cctcaccttgatacgagatatatagacaataaaaaagctttactatttggaccgttcgca
gggttttctcctaagttcttaaaaactggctcaaatcttgacttaattggttctgtaaaa
ccaaataacgtcttaacgatgttagctgccggtgtaaaagaaatgggactaacaaaatac
ttaattcagcaagttatgttatcacatgaaaaacgtatggaagaattacgcgaattcatt
ccgaacgcaaaaagtgaagattgggatattgtagttgctggtcagcgtgtacaagtaatt
aaagatactgatgctggcggtaaaggaacacttcaattcggtacagaagttgttagtgcg
gctgatggatcaatcgcagcattactaggtgcttcaccgggtgcttctactgccgttcat
gttatgcttgaagtattagaaaaatgtttcccaagccgaatggtagaatgggaaggaaaa
ataaaagaaatgattccttcttacggcatttcattaacagaaaatccaagattattccaa
gaccttcacacttctacaggtcgtacccttggattaaatgaaaaagaaacagttcataat
taa

DBGET integrated database retrieval system