KEGG   Bacillus thuringiensis Al Hakam: BALH_3375Help
Entry
BALH_3375         CDS       T00429                                 

Gene name
pgm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00010  Glycolysis / Gluconeogenesis
btl00260  Glycine, serine and threonine metabolism
btl00680  Methane metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01130  Biosynthesis of antibiotics
btl01200  Carbon metabolism
btl01230  Biosynthesis of amino acids
Module
btl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btl_M00002  Glycolysis, core module involving three-carbon compounds
btl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_3375 (pgm)
  Energy metabolism
   00680 Methane metabolism
    BALH_3375 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BALH_3375 (pgm)
Enzymes [BR:btl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BALH_3375 (pgm)
Membrane trafficking [BR:btl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BALH_3375 (pgm)
Exosome [BR:btl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BALH_3375 (pgm)
  Exosomal proteins of melanoma cells
   BALH_3375 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF816 DUF1482
Motif
Other DBs
NCBI-ProteinID: ABK86612
UniProt: A0RHB9
Position
complement(3574090..3574665)
Genome map
AA seq 191 aa AA seqDB search
MNTYIYMVRHGESPKLDGGERTRGLTEKGSLDVHKVTDILKTEGIDTFISSPYKRAVLTI
EKTANLYEKEILIYENLKECMFSSGDQVISDKEVYPLVKKMFSNPDFALAEGESYADCQR
RVVKVLKEILMDFQGQKIVIGTHGLVMTLMMNYFDKQYGFELLMNTSKPDIYKMEFKEKQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatatatttatatggttagacacggtgaatcaccaaaattagatgggggtgaa
agaacacgtggtttaactgaaaagggaagtttagacgttcataaagtaacagatatatta
aaaacagagggaatcgatactttcatttcaagtccgtataagagggctgtattaacgata
gaaaaaacagctaatctctatgaaaaagaaatattaatatatgaaaaccttaaagagtgt
atgttttccagtggggatcaagttatatcagataaagaagtgtatccacttgtaaagaag
atgttctctaatcctgactttgcactagcggaaggagagtcatatgcggattgccagaga
agagtagtgaaagtgttaaaagaaatattaatggattttcaaggacaaaaaattgtaatt
ggtacacatggtcttgtcatgacattaatgatgaactatttcgataaacaatatggtttt
gaacttttaatgaatacgtcaaaaccagatatatataagatggagtttaaagaaaaacaa
ttaatgaatgtagagagattatggaaagcggaataa

DBGET integrated database retrieval system