KEGG   Bacillus thuringiensis Al Hakam: BALH_3542Help
Entry
BALH_3542         CDS       T00429                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00471  D-Glutamine and D-glutamate metabolism
btl00550  Peptidoglycan biosynthesis
btl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BALH_3542
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BALH_3542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btl01011]
    BALH_3542
Enzymes [BR:btl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BALH_3542
Peptidoglycan biosynthesis and degradation proteins [BR:btl01011]
 Precursor biosynthesis
  Amino acid ligase
   BALH_3542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C 2-Hacid_dh_C Mur_ligase DUF1188 SsgA PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ABK86776
UniProt: A0RHT3
Position
complement(3761338..3762690)
Genome map
AA seq 450 aa AA seqDB search
MKTVTEFQNKNILVLGIAKSGYAAATLLQKLGANVIVNDGKPLAENVLAAELQAKGMDVV
CGGHPLELLERNISLVVKNPGIPYSNPILVAAKEKQIPIVTEVELAYRISEAPFVGITGS
NGKTTTTMLTFEMLKEGQKHPVIAGNIGTVACEVAQDAKENEVVVTELSSFQLMGVELFQ
PKIAAFLNLFEAHLDYHGTKKEYGLAKANIFKNQTENDYSVINADDADVMALSAYSKGQK
VLFSTTKEIEDGACIKDNALYFKAEKVVEVDDIVLPGQHNLENILAAMSIAKLLGVSNEA
ITAVLKRFTGVKHRLEYVTTINNRKFYNDSKATNMLATEKALSAFTQPTVLLAGGLDRGN
EFDDLIPYFKNVKAIVTFGQTAPKLVRAAEKAGLETIESVDTLDEAVVKAYAHSTDGDVI
LLSPACASWDQFKTFEERGDIFIQAVHKLI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactgtaactgaatttcaaaataaaaatattcttgtattaggcattgcaaaaagt
ggttatgcagcagctacattgctacaaaagttaggggcaaatgttattgtaaatgacgga
aagccgttagcagaaaatgtactcgctgcagaattacaagcaaaaggaatggacgttgta
tgcggtggtcatcctttagaattattagagagaaatatttctcttgtagtaaaaaatcca
ggaatcccgtattctaatccaatattagttgctgcgaaagaaaagcaaattccaattgtt
acagaagttgaattagcatatcgtatttcagaagcaccatttgttgggattacgggatct
aacggtaaaacgacgacgacaatgcttacatttgaaatgctaaaagaaggacagaagcat
ccggtaattgcagggaacattggaactgtagcgtgtgaagttgcacaggatgcaaaagaa
aatgaagttgtagttacagaactttcatcgttccaattgatgggagtagaattgttccaa
cctaaaattgctgcgtttttaaatttatttgaggcccacttagattatcatgggacgaag
aaagaatatggtttagcaaaagcaaatatttttaaaaaccaaacagaaaatgattatagt
gtaataaatgcagatgatgcagatgtgatggctttatctgcttatagtaaaggtcaaaaa
gtactattctcaacaacgaaagaaattgaagatggtgcgtgtataaaagataatgctctt
tattttaaagctgaaaaagttgttgaagtagacgatatcgttttacctggacaacataat
ttagaaaatattttagcagcgatgagtatcgcaaaattattgggtgtttctaacgaagcg
attacggcggtgttaaaacgttttacaggtgtaaaacatcgtttagaatatgtaacaact
ataaacaaccgtaagttttataatgactcaaaagcaacgaatatgttagcgacagagaaa
gctttatctgcgtttacacaaccgactgtgttattagcaggtggacttgatcgtgggaat
gagttcgatgatttaattccgtatttcaaaaatgttaaagcgattgtaacatttggacaa
accgctccaaaactagtaagagctgcagaaaaagcaggattagagacaattgaaagtgtc
gatactttagatgaagcggtagtaaaagcttatgctcattctacagatggcgatgtaatt
cttctttctccagcatgtgcaagctgggatcaatttaaaacatttgaagaaagaggagac
atttttatacaagccgtgcataaacttatataa

DBGET integrated database retrieval system