KEGG   Bacillus thuringiensis Al Hakam: BALH_3642Help
Entry
BALH_3642         CDS       T00429                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00071  Fatty acid degradation
btl00072  Synthesis and degradation of ketone bodies
btl00280  Valine, leucine and isoleucine degradation
btl00310  Lysine degradation
btl00362  Benzoate degradation
btl00380  Tryptophan metabolism
btl00620  Pyruvate metabolism
btl00630  Glyoxylate and dicarboxylate metabolism
btl00640  Propanoate metabolism
btl00650  Butanoate metabolism
btl00900  Terpenoid backbone biosynthesis
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
btl01130  Biosynthesis of antibiotics
btl01200  Carbon metabolism
btl01212  Fatty acid metabolism
btl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BALH_3642 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BALH_3642 (fadA)
   00640 Propanoate metabolism
    BALH_3642 (fadA)
   00650 Butanoate metabolism
    BALH_3642 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BALH_3642 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BALH_3642 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BALH_3642 (fadA)
   00310 Lysine degradation
    BALH_3642 (fadA)
   00380 Tryptophan metabolism
    BALH_3642 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BALH_3642 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BALH_3642 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BALH_3642 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btl04147]
    BALH_3642 (fadA)
Enzymes [BR:btl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BALH_3642 (fadA)
Exosome [BR:btl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BALH_3642 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABK86874
UniProt: A0RI31
Position
complement(3868277..3869452)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccgaaaattatgggtattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgcg
caatacttagctgtagagaaagaattaggtctggatcgtgaaaaagtgaatgtaaacggt
agtggtgtaggacttggacatccaatcggttgtacaggagctcgtatcactgtaagttta
attcatgaattgaagagacgtggcttagaaaaaggaattgcctcgctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system