KEGG   Bacillus thuringiensis Al Hakam: BALH_3786Help
Entry
BALH_3786         CDS       T00429                                 

Gene name
ispA
Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00900  Terpenoid backbone biosynthesis
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01130  Biosynthesis of antibiotics
Module
btl_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BALH_3786 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:btl01006]
    BALH_3786 (ispA)
Enzymes [BR:btl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BALH_3786 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BALH_3786 (ispA)
    2.5.1.29  geranylgeranyl diphosphate synthase
     BALH_3786 (ispA)
Prenyltransferases [BR:btl01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BALH_3786 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt Hpr_kinase_C UbiA
Motif
Other DBs
NCBI-ProteinID: ABK87013
UniProt: A0RIH0
Position
complement(4003485..4004375)
Genome map
AA seq 296 aa AA seqDB search
MTIAFDTFLKESKTFVEEKLVSYANELQCPNVLREAMAYSLEAGGKRLRPLLLFATLQAF
DKERNLGVGAACALEMIHTYSLVHDDLPCMDDDDLRRGKPTNHKVFGEAMAVLAGDGLLT
YAFQVIMAYGQKEISAEKKVRLVLELAKAAGPEGMVGGQVADMEAEGKQLTIDELEYIHK
HKTGKLLEFAVLAGSILSDATEEQEEKLLEFAKYIGLAFQIRDDILDVEGTEEEIGKPIG
SDVSNEKSTYTTLFTVDRAKDILDETIAKAKDAIGSLQLQDEYLLSICDLIAKRNN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgacaattgcttttgatacttttttaaaagaaagtaaaactttcgtagaagagaagctt
gtaagctatgcaaatgaattacaatgtccaaatgtacttcgtgaagcgatggcatattct
ttggaagcgggtggaaagcgtctccgcccgttacttttatttgcaacattacaagcgttt
gataaagaaagaaatcttggagtaggtgcagcttgtgctcttgaaatgatacatacatac
tcgttagttcatgatgatttaccttgtatggatgatgatgatttaagaagaggaaagccc
acaaatcataaagtatttggtgaagcgatggcagttttagcaggtgatggtttgttaacg
tatgcttttcaagttattatggcatatggacaaaaggaaatctctgctgagaaaaaagta
agacttgtacttgagcttgcaaaagcggcagggccagagggaatggttggcggacaagtg
gcagatatggaagcggaagggaaacagcttacgatcgatgagctagagtatattcataag
cataagactgggaaactacttgaattcgctgtacttgcaggatcgatactttctgatgcc
acagaagaacaagaagaaaaattacttgagtttgcaaaatatatcggcttagctttccaa
attcgagatgatattttagatgtggaaggaaccgaagaagagattggaaaaccgattggt
agtgatgtttccaacgaaaagagcacatatacgacgttgtttactgtagatagagcaaag
gatattttagatgaaactattgcaaaagcaaaagatgctattggttccttgcaattacaa
gatgaatatttactatctatttgcgatttgattgcaaaacgtaataactaa

DBGET integrated database retrieval system