KEGG   Bacillus thuringiensis Al Hakam: BALH_4056Help
Entry
BALH_4056         CDS       T00429                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00860  Porphyrin and chlorophyll metabolism
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BALH_4056 (hemD)
Enzymes [BR:btl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BALH_4056 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABK87273
UniProt: A0RJ80
Position
complement(4277363..4278115)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLITRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIAGQLHSYDW
VIFTSKNGVAFFLDSLRKKLPVTTKIAAVGVKTKLELEKRGYHVDFVPTSFVAEVFAEEF
VKRLSGNERILFPKGNLAREVIPVALREIGVSLDELIVYGTKVNIEKKQELIAALKLGKV
DIITFTSPSTVTSFVRLLDGTNWREWTKKCTIACIGPITEKEASLYFPHVIMPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggcaaaacggtattgattacacgtgcccagcaccaagcaaaacaa
atgagtgtagcggtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gagggtatgtctcataggcaaattcaacatatagcagggcagttacattcgtatgactgg
gttatttttacgagtaaaaatggggtagctttttttctagattctttgagaaagaagctc
cccgtaacgactaaaattgctgcagtaggcgtgaaaacaaagttagagttagaaaagcga
ggctatcatgtagactttgttccaacttcatttgttgcagaagtatttgcagaagagttt
gtaaaaagattaagtggaaacgaacgtattttatttccgaaagggaatttagcaagagag
gtaattccggttgcacttcgggaaattggtgtttctctagatgagctaatcgtatacggt
acgaaagtgaatatagaaaaaaagcaagagcttatagcagcattgaagttagggaaagta
gacattattacatttacgagcccttcaactgttactagttttgttcgtttacttgatggt
acaaactggagagaatggacaaaaaaatgtacaattgcttgtatagggcctattacggaa
aaagaggcgagcctttattttccgcatgttattatgccgaaagagtacactgtagaagca
ttactacaatgcgtttgtgaatctataaaataa

DBGET integrated database retrieval system