KEGG   Bacillus thuringiensis Al Hakam: BALH_4799Help
Entry
BALH_4799         CDS       T00429                                 

Gene name
nuoH
Definition
(GenBank) NADH dehydrogenase subunit H
  KO
K00337  NADH-quinone oxidoreductase subunit H [EC:7.1.1.2]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00190  Oxidative phosphorylation
btl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BALH_4799 (nuoH)
Enzymes [BR:btl01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BALH_4799 (nuoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADHdh
Motif
Other DBs
NCBI-ProteinID: ABK87980
UniProt: A0RL87
Position
complement(5057288..5058289)
Genome map
AA seq 333 aa AA seqDB search
MIETLLQSPSSWTNFFIFFGLAVLLLFAVLGFVTYGILAERKVMGFMQGRIGPNQVGGRF
GLLQTVADVLKLLLKEDSIPKAADKPLFILAPVIAFAPAFMVLAVIPFTDKFQFADIGVG
LLYYIAVSGITTIGVVTGGWASNNKYSLLGGMRAAAQMISYEIPLVMSVIGIVLLAGSLN
LNEIVAAQENVWYIFVQPIGFVVFLIAAVAELNRTPFDLPEAESELVSGYHTEYSGFRWA
FFMLSEYVYFFGMASLITVLFLGGWNPVMFLGFIPGAVWFALKFSSVVFLLIWFRVTFPR
IRGDQLMEFGWKVLLPIALANIFLTALIKELFF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaacgctcttacaatcaccttcaagctggacgaatttcttcatttttttcgga
ttagcggtgctcctattatttgcagtccttggcttcgttacatatggaattttggcagaa
cggaaagtgatgggttttatgcaaggacgaattgggccaaaccaagtcgggggccggttc
ggtctgctgcaaacggtagctgatgttttaaaactactactaaaagaagatagtattccg
aaagcggcagataaaccgttgtttatattagcgcctgttattgcattcgcgccagcattt
atggtgcttgcagtcatcccgtttactgataaatttcagttcgcggatattggcgtaggc
ttactgtattacattgctgtttctggcattacgacgattggcgtcgtaactggagggtgg
gcatccaataataaatattcccttttaggagggatgcgtgcggcggcgcaaatgatttct
tatgaaattccgctcgtaatgagtgtaattggcatcgttttgttagctggtagcttaaat
ttaaatgaaatcgtagcagcgcaggagaatgtttggtacattttcgtgcaaccaatcggt
ttcgtcgtgtttttaatcgcagcggtagcagagttaaataggacgccgtttgatttacca
gaagcagaatcggaacttgtttctggatatcatacggaatactcagggtttcgctgggcg
tttttcatgctttcagagtacgtatattttttcgggatggcatcgttaattacagtgctc
tttttaggcggatggaatccagttatgttccttggatttattccaggtgccgtatggttt
gctttaaagtttagcagtgtagtttttctattaatttggttccgcgttacgtttccgcgt
ataagaggtgatcagttaatggagtttggctggaaagtattattgccaattgcacttgca
aatattttcttaacggcattgattaaggagttattcttctaa

DBGET integrated database retrieval system