KEGG   Bacillus thuringiensis Al Hakam: BALH_4856Help
Entry
BALH_4856         CDS       T00429                                 

Definition
(GenBank) aminopeptidase
  KO
K19701  aminopeptidase YwaD [EC:3.4.11.6 3.4.11.10]
Organism
btl  Bacillus thuringiensis Al Hakam
Brite
KEGG Orthology (KO) [BR:btl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:btl01002]
    BALH_4856
Enzymes [BR:btl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     BALH_4856
    3.4.11.10  bacterial leucyl aminopeptidase
     BALH_4856
Peptidases and inhibitors [BR:btl01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   BALH_4856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ABK88035
UniProt: A0RLE2
Position
5126840..5128279
Genome map
AA seq 479 aa AA seqDB search
MSVRENRRIGEEKMKKSLKQKIVSSLLAVSLAVSLAPIGQAKADSTSEIKQTSSITKQVD
ASRAIEHIRFLSETIGPRPGGTKSEEWASRYVGMQLKSMGYEVEYQPFQVPDQYVGFIES
PLSTKRNWQAGAAPNALISTESVTAPLIFVQGGTKLEDIPNEVNGKIVLFERGTTVADYN
KQVENAVSKGAKGVLLYSLIGGRGNYGQTFNPRLTKKQSIPVFGLAYAQGNAFKEEIAKK
GTTILSLKARHESNLTSLNVIAKKKPKNSTGNEKAVVVSSHYDSVVGAPGANDNASGTGL
VLELARAFQNVETDKEIRFIAFGSEETGLLGSDYYVNSLSQKERDRILGVFNADMVATNY
DKAKNLYAMTPNGSPNLVTDAALQAGKQLNNDLVLQGKFGSSDHVPFAEVGIPAALFIWM
GVDSWNPLIYHIEKVYHTPQDNVFENISPERMKMALEVIGTGVYNTLQQSVTQTEQKAA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtcagagagaatagaagaataggagaggaaaaaatgaaaaaatctttgaaacaa
aaaatagtaagctccttgcttgctgtatcactcgctgttagcttagctccgattggacaa
gctaaagctgattctacgtcagaaatcaagcagacttcatctatcacaaaacaagttgat
gcaagccgcgctatcgaacacatccgtttcttatccgaaacaattggtcctcgacctggc
gggacaaaatcagaagaatgggcttcccgctacgttggtatgcagcttaaatcaatgggc
tacgaagtagaatatcaaccattccaagtgccggatcaatacgttggatttattgaatca
ccattatccacaaagcgtaattggcaagctggtgctgcccctaacgcactaatttctaca
gaatctgttacagctcctcttatctttgttcaaggtgggacaaaattagaggatatccca
aatgaagtaaatggaaaaattgttctattcgaaagaggaacaacagtagctgactataat
aaacaagttgaaaatgctgttagcaaaggagcaaaaggtgttcttttatacagtttaatt
ggtggacgtggaaactacgggcaaactttcaatccccgcctaacgaaaaagcaatctatc
cctgtctttggtcttgcttatgcgcaaggaaatgcatttaaagaagaaatcgctaaaaaa
ggaacaacaattctttccctaaaagcgagacatgaatctaatttaacatcattaaacgtc
atcgctaaaaagaaaccaaaaaacagtacaggtaatgaaaaagctgtcgttgtaagttca
cactacgatagtgtcgttggagcacccggagcaaatgataatgcttctggtacaggatta
gtattagagttagctcgcgcttttcaaaatgtagaaactgataaagaaattcgttttatt
gcttttggttctgaagagactggcttacttggctccgattattacgttaatagcttatcc
caaaaagaacgcgatcgaattttaggtgtctttaacgcagacatggtcgcaacaaattac
gataaagcaaagaatttatatgctatgacgcctaacggttctccaaaccttgtaacagac
gcagccttacaagcaggtaaacaattaaataatgacctcgttctacaagggaaatttggc
tctagtgatcacgtaccgtttgctgaagttggtattcctgcggctctatttatttggatg
ggtgtcgatagttggaatccattaatctaccatatcgaaaaggtatatcacacacctcaa
gataatgtatttgagaatatttcacctgaacgtatgaaaatggcactagaagtaatcgga
actggtgtttataacactcttcaacaatctgttacgcaaacagaacagaaagctgcttaa

DBGET integrated database retrieval system