KEGG   Bacillus thuringiensis MC28: MC28_1172Help
Entry
MC28_1172         CDS       T02263                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00260  Glycine, serine and threonine metabolism
btm00750  Vitamin B6 metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC28_1172 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MC28_1172 (thrC)
Enzymes [BR:btm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MC28_1172 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AFU12594
UniProt: K0FM65
Position
1138928..1139986
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYAAYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIHLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSAAAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQKAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSRGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNKLDIASVSNDIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaaacagtatgctgcttatttaccagtgaatgaaaacacacct
gatgtcagtttaatggaagggaatacacctctaattccattattaaatatatcaaaacaa
ttagggattcacttatatggtaagtatgaaggagcgaatccaacaggttcttttaaagat
cgtggtatggtaatggcggttgctaaagcgaaagaagaaggttctgaggcaatcatttgt
gcatcaacaggtaatacatcggcagcggctgcagcatatgcggcacgcctcggaatgaaa
tgtattatcgtaatcccggaaggaaagattgcgcacggaaaattagcgcaagcagtcgct
tatggagctgaaatcatttcaatagaaggaaattttgatgatgcacttaaggctgtaaga
aacattgctgcagaagagccaattacattagtaaactcagtgaacccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgaccagttgcaaaaagcgccagatgttctc
gctattcctgttgggaatgcagggaatattacagcatactggaaagggttctgtgaatat
gagaaagaaaaaggctacaaaaagccaagaattcacggctttgaagcggaaggagcagct
gcaattgtaaaaggacatgtaattgaagaacctgaaacaattgcaacagctatacgtatc
ggtaacccagcgagttggtcatatgcagtagaggctgctgagcagtctcgaggcgagata
gatatggtatcagatgaggaaatattacatgcgtatagattgttagcaaaaacggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagtagttgcggtattaactggaaatggtttgaaagat
cctgatatcgcaatttcttctaataaattagatattgcaagtgtttcaaatgatatagaa
caaattaaagaacatataaaaggggtgattatgtcgtga

DBGET integrated database retrieval system