KEGG   Bacillus thuringiensis MC28: MC28_1439Help
Entry
MC28_1439         CDS       T02263                                 

Definition
(GenBank) Alcohol dehydrogenase 1
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00010  Glycolysis / Gluconeogenesis
btm00071  Fatty acid degradation
btm00350  Tyrosine metabolism
btm00625  Chloroalkane and chloroalkene degradation
btm00626  Naphthalene degradation
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_1439
  Lipid metabolism
   00071 Fatty acid degradation
    MC28_1439
  Amino acid metabolism
   00350 Tyrosine metabolism
    MC28_1439
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MC28_1439
   00626 Naphthalene degradation
    MC28_1439
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MC28_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C TrkA_N Methyltransf_31 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFU12861
UniProt: K0FLX7
Position
1397856..1398893
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKLADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQDEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGKIQGRMVIDFKQNSCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtggttaataaaaacagcaaagcgaacatcgaggttatcgaaaaagaa
ttacgtccgttacattcaggtgaagcgttagtagatgtagagtattgtggggtttgccac
actgatttacacgttgcgaatcatgattttggtaacacggatggccgcatccttggtcat
gaaggtgtaggtatagttactaaacttgctgatgatgtaacttcacttaaggttggtgac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtaactggt
agagagacattctgtcgtgaagttaaaaatgctggttattcagtagatggtggtatggct
gaacaatgtatcgttacagctgattatgcagtgaaagtaccagaaggattagatcctgct
caagcatcatcaattacatgtgcaggcgtaactacatataaagctattaaagtatcagat
attaaacctggtcaacctatcgtcatctatggttgtggtggattaggtaacttagctatc
caatatgctaaaaacgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ttagccttagcaaaagaggttggtgctgatatgactatcaatccaatttctcaaggtcct
gctgataagattgtgcaagatgagtttggtggtgcttatgctgctgtagtaacagccgtt
tctaaagtagcattcaactcagcggttgatgcagtacgtgcctgtggtaaagtagttgcg
gtagggttaccagtagaaactatggatttaaacattccacgacttgtactagacggaatt
gaagtagttggctctctagtaggtactcgtaaggatctcgaagaggcatttatgttcggt
gcagaaggaaaagtagtaccggttgttcaaacgtgttctctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtaaaattcaagggcgtatggtaatcgattttaaacagaat
agttgtgattgtaaatag

DBGET integrated database retrieval system