KEGG   Bacillus thuringiensis MC28: MC28_2773Help
Entry
MC28_2773         CDS       T02263                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00071  Fatty acid degradation
btm00072  Synthesis and degradation of ketone bodies
btm00280  Valine, leucine and isoleucine degradation
btm00310  Lysine degradation
btm00362  Benzoate degradation
btm00380  Tryptophan metabolism
btm00620  Pyruvate metabolism
btm00630  Glyoxylate and dicarboxylate metabolism
btm00640  Propanoate metabolism
btm00650  Butanoate metabolism
btm00900  Terpenoid backbone biosynthesis
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01200  Carbon metabolism
btm01212  Fatty acid metabolism
btm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC28_2773
   00630 Glyoxylate and dicarboxylate metabolism
    MC28_2773
   00640 Propanoate metabolism
    MC28_2773
   00650 Butanoate metabolism
    MC28_2773
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC28_2773
   00072 Synthesis and degradation of ketone bodies
    MC28_2773
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC28_2773
   00310 Lysine degradation
    MC28_2773
   00380 Tryptophan metabolism
    MC28_2773
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC28_2773
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC28_2773
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC28_2773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btm04147]
    MC28_2773
Enzymes [BR:btm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC28_2773
Exosome [BR:btm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC28_2773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFU14195
UniProt: K0FW18
Position
complement(2724741..2725832)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGILKDYEVQQLVAPLLSFLGKGIEREIDDVILGNVVGPGGNI
ARLSVLEAGLSYHIPGVTIDRQCGAGLEAIRTACHLIQGGAGKCYIAGGVESTSTSPFQN
RARFSPETIGDPDMGVAAEFVAERYNITKEMQDEYACLSYKRTLQALENGYIQDEVLLLN
GLLDEVIKREMQYERMIKRTKPAFLQNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPNLPGTGPIFAVQKLLREMNLAIEDIDCIEMNEAFASKIVACAKELQ
IPYEKLNVNGGAIALGHPYGASGAMLVTRLFYQAKRDSMKYGMATLGIGGGIGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaggcgaaaagaacgcccattggtaagaagaatgggata
ttgaaagactatgaagttcagcaattagtagcaccacttctttcatttctaggtaaagga
attgagagggaaatagacgatgttatattagggaatgttgttggaccagggggtaatatt
gcaagattatctgttttagaagcaggacttagttatcatattcctggtgtaacgattgat
cggcaatgtggtgctggtttagaagcgattcgtaccgcgtgtcatctcattcaaggtggg
gcaggtaagtgctatatcgccgggggagtagagagtacaagtacgtcaccttttcaaaat
agagcgcgattttcacctgaaacaattggtgatcctgatatgggagtagcggctgaattt
gttgcagagcgttataacataacgaaagaaatgcaagatgagtacgcttgcttaagttat
aagcggacgctacaagcattagaaaatggatatatacaagatgaagtattgttacttaat
ggattactagatgaagtaataaagcgagaaatgcagtatgaaagaatgattaagagaaca
aaacctgcatttttacaaaatggaacggtgacggcagggaattcgtgtggtgtaaatgat
ggggcgtgtgctgtacttgtaatggaagaggggcaagctcgaaaattaggatataagcca
gttcttcgtttcgttcgcagtgctgtagttggagtggatccaaacctcccgggaactggt
ccgatatttgccgtgcaaaaactacttagagaaatgaatttagcaatagaagatattgat
tgtattgagatgaatgaagcgttcgcttcgaaaattgttgcttgtgcaaaagaattacaa
attccatatgagaagctcaatgtgaatggtggtgcaattgcgctcgggcatccgtacggt
gcatctggcgctatgcttgtgacacgtttgttttatcaggcaaaaagagattctatgaaa
tatggaatggcgacattaggaattgggggcggaataggacttgctctattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system