KEGG   Bacillus thuringiensis MC28: MC28_3094Help
Entry
MC28_3094         CDS       T02263                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00230  Purine metabolism
btm01100  Metabolic pathways
Module
btm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MC28_3094 (gmk)
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MC28_3094 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase MMR_HSR1 AAA_33 Rad17
Motif
Other DBs
NCBI-ProteinID: AFU14516
UniProt: K0FRG7
Position
complement(3046160..3046777)
Genome map
AA seq 205 aa AA seqDB search
MRSRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKER
EEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGV
FIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIEMMDAYDYVVENDQVELACDRI
KAIVVGEHCRRERVAKYYKEMTEGL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtagaagaggattgctcatcgttctttcaggaccttctggggttggtaaagga
acggttcgaaaagagctgtttagccatgaggatacacgttttcaatactctatttcagta
acgacacgtaagccgcgtgaaggtgaagtagatggtgtggattatttctttaaagagaga
gaagaatttgaggaaatgattcgtaatgaaaaattacttgagtgggcggagttcgtaggt
aattattacggaacaccgattgactatgttgaaaaaacattacaagaaggaaaagatgta
ttcttagaaattgaagtgcaaggagcaattcaagttaagaaagctttcccagaaggtgta
tttattttcttagcacccccaagtttatctgagctaaaaaaccgaattgtcggccgtggt
acagaaactgaagatgttattgaaaatcgcttaactgtagcgaaagaagaaatcgaaatg
atggacgcttacgactatgttgtagaaaatgatcaagttgaattagcttgtgatagaatt
aaagcaattgtggttggtgaacattgccgccgcgaaagagtagcaaaatattataaagaa
atgacggagggtctataa

DBGET integrated database retrieval system