KEGG   Bacillus thuringiensis MC28: MC28_3559Help
Entry
MC28_3559         CDS       T02263                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00051  Fructose and mannose metabolism
btm00520  Amino sugar and nucleotide sugar metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MC28_3559
   00520 Amino sugar and nucleotide sugar metabolism
    MC28_3559
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MC28_3559
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     MC28_3559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep PGM_PMM_I
Motif
Other DBs
NCBI-ProteinID: AFU14981
UniProt: K0FSQ8
Position
complement(3452575..3454929)
Genome map
AA seq 784 aa AA seqDB search
MKGVILAGGKGRRLRPLTCNTPKPMLPLLEKPVLEYNIELLRQHGIREIAITVQYMSAAI
KQYFGDGSKWGVDLYYFEDSPPLGTAGSIKQAENFLDETFVVISGDALTDFRLSEGIAFH
EQKKRMVTMFVKEVENPLSFGLVVMNKEQEVTRYIEKPSWNEVISNIVNTGIYIMEPEIF
SYIPPREFFDFSQDVFPLLANKNALFAYLSEGYWLDIGTFDQYRQAQFDLLTKKLQVPIP
YTEVLPMVWMGEGVTIGKGTKIHGPSFIGEGAKIGAGAVIEPYSIIGKNSIVSSYSHLQK
SIVFANAHIGEYCELLETTIGEHTMVEDDVTLFQKSIVADHCHIGKSTVIKQKGKLWPYK
AIDSHSIVGSAGVQESEKSAGWLQKSRIVGRGNVEITPQFIVKVAMAYGSLFGKGESILI
GSQEHIETTSYKNLFLHAIHGIGIHTMECKEMNESLFQYSIHNLQCAGGVFVQVENEKEV
VIKLYGKDGMLLTYKQQKAIEQVYMSESFYYVCEKEMGQNTPVHVSLNDYIEAVLECIDI
EQIQKQKFHLLINKRNDMLQHLLMLFLQRLGCTVTWIYAGEQKDHVKALMKSSKANMALM
FSEQGNYFELYDNHSNIYQGTDFEEIDLPDLLLESKGNIYPMSLKLGECYLLFYIHDEKK
AFQVKWKRDILYRIGKLFELTALQEKAFLSIVEQSPPLYLLYDEVVCSWNEKGKVMRKLL
ADMERKEEGIFEGVQFKYTEKEWSYIVSDTKQPKFLVYSHARNPVIARENMKNLIEKIRQ
YQKV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggttattttagctggaggaaaaggaagacgccttagaccattaacatgtaat
actccaaagccgatgttgccattattagaaaaaccagttttggaatacaatattgaattg
ttacgtcagcatggtattcgtgaaattgcaattacagttcaatatatgagtgcggccatt
aagcaatattttggcgatggtagtaaatggggagttgacttgtactattttgaagactcc
cctccacttggaacggcaggaagtattaaacaagcggaaaactttttagatgaaacattt
gttgttataagtggggatgcattaactgattttcgattatcagaaggaattgcgtttcat
gaacaaaagaaaagaatggtaactatgtttgtaaaggaagtagaaaacccactctcattc
ggtttggttgtaatgaacaaagaacaagaggttacacgatatatagaaaaaccgagctgg
aatgaggtaatctccaatattgtgaatacagggatttatattatggagccagaaatcttt
tcttacatacccccccgagaattttttgatttcagtcaagatgtgtttccattattagca
aataagaacgcgttatttgcatatttgtcagaaggttattggttagatattggtacattt
gatcaatatcgacaagcacaatttgatttgttaacgaaaaaattgcaagtacctattcct
tatacggaagtgttaccgatggtatggatgggagaaggtgtgacgattggaaaagggacg
aaaattcatggcccatcttttattggagaaggagcaaagattggtgcgggggctgtaatt
gagccgtactctattatcgggaaaaatagtattgtttcaagttactctcatcttcaaaaa
agtattgtttttgcaaatgctcacattggggagtattgtgagctattagaaacgacaata
ggagagcatacaatggttgaagatgacgttacgttgtttcaaaaaagtattgtagcggat
cattgtcatatagggaagagtacggtcattaagcaaaaaggaaaattatggccttataag
gctattgatagtcattcgatagtaggatcggctggtgttcaagaaagtgaaaaaagcgct
ggctggttacaaaaaagccgtattgtagggagagggaatgttgagattactccgcaattt
attgtaaaagtggcgatggcgtatggatctctttttggaaaaggggaaagcatactaatt
gggagtcaagaacatatagaaacaacttcttataaaaatttatttttacatgctattcat
ggtatcgggattcatacgatggaatgtaaagagatgaacgagtcactttttcagtatagc
attcataatttgcaatgtgcaggtggggttttcgttcaagtggaaaatgaaaaagaagtt
gttataaagctgtatggtaaggatgggatgctgttaacgtataagcagcaaaaagcaata
gaacaagtatatatgtccgagtcgttttattacgtatgtgagaaagaaatgggacaaaat
acgccagtccacgtttctttaaatgactatatagaagctgtattagaatgcattgatatt
gaacaaatacaaaaacaaaagtttcatcttcttattaataagagaaatgatatgttacaa
catttacttatgctctttcttcaaaggcttgggtgcacagttacatggatttatgcgggc
gaacaaaaagatcatgtgaaagctttgatgaaatcaagtaaagcgaatatggcgcttatg
ttttctgagcaaggaaattatttcgagttatatgataatcatagtaatatttaccaaggt
acagattttgaagaaatagatcttcctgacttattactggaatcaaaagggaatatttac
ccaatgtctttgaaattaggagaatgttaccttctattttatatacatgatgaaaaaaag
gcatttcaagtaaagtggaaacgagatattttatatcgaattggaaagttattcgagtta
acagcactgcaagaaaaggcgtttcttagcatagtagagcaatcaccgccgctttattta
ctttatgatgaagttgtgtgttcatggaacgaaaaagggaaagtgatgaggaaattattg
gccgatatggaaagaaaggaagaaggtatatttgaaggagtgcagttcaaatataccgaa
aaagagtggtcttatatcgtttctgacacaaaacaaccaaaatttttggtgtattcacat
gctagaaatccagtgatagcaagggaaaacatgaaaaatcttatagaaaaaattagacaa
tatcaaaaggtgtag

DBGET integrated database retrieval system