KEGG   Bacillus thuringiensis MC28: MC28_4753Help
Entry
MC28_4753         CDS       T02263                                 

Gene name
metG1
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00450  Selenocompound metabolism
btm00970  Aminoacyl-tRNA biosynthesis
btm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MC28_4753 (metG1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MC28_4753 (metG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btm01007]
    MC28_4753 (metG1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btm03016]
    MC28_4753 (metG1)
Enzymes [BR:btm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MC28_4753 (metG1)
Amino acid related enzymes [BR:btm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MC28_4753 (metG1)
Transfer RNA biogenesis [BR:btm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MC28_4753 (metG1)
 Prokaryotic type
   Other AARSs
    MC28_4753 (metG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f PPP1R35_C
Motif
Other DBs
NCBI-ProteinID: AFU16175
UniProt: K0G2C4
Position
4637961..4639943
Genome map
AA seq 660 aa AA seqDB search
MTKENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQ
KKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDI
YLDEYEGWYSVQDETFYTAHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYV
DRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWV
DALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFA
HGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINF
DLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLQKVEDAMENMEFS
VALSSIWQLVSRTNKYIDETQPWVLAKDENDREKLASVMAHLAEVLRQTGIMLMPFLTVA
PSKMFAQLGLTEEAHKSWESLSIIGCIPGGTKVEKGNPIFPRLEMEVEVEYIKEQMKSSA
PKVEEKKEEEPQAEEITIDDFFKVELRVAEVISAEPVKKADKLLKIQLDLGTEKRQVVSG
IAKFYSPEDLQGKKVICVTNLKPVKLRGELSQGMILAGEENGVLSLATIDQNLPNGTKIK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaaataagtccttttatattactaccccaatttattatccaagtggaaag
ttacacattggacatgcttatacgacagtagcaggagatgcaatggcacgatataagcgt
atgcaaggctacaatgttcattatctaacaggaactgatgagcatgggcagaagatccaa
aagaaagcagaagagttaaatgtgacaccacaagcatacgtggataatattgttgcagga
attaaagagctttgggagaagatggatatctcttatgatgattttattcgcacaactgaa
gatcgtcataaagatgttgtcgaaaagatcttcaagcaactagtagaccaaggtgatatt
tatcttgatgaatatgaaggttggtattctgtacaagatgaaacattctatacagcgcat
caattagtagatccaattatggaaggtgacaaagtagttggaggaaaaagtccagatagt
ggtcatgatgtagaacttgttcgtgaagaatcatatttctttagaatgggtaaatatgtc
gacagactattaaagttctatgaagataatccacattttattcagccagagtctcgtaaa
aatgaaatgattaataacttcattaaaccaggattagaagatttagcagtttctcgtact
tcatttgattggggagttcgtgttccaggcaacccaaaacatgttatttacgtatgggtt
gatgcattatctaactacattacagcattaggttatggaacagaaaatgaagagatgtat
aagaaattctggccggcagatgtgcatttagtcggaaaagaaattgttcgtttccataca
atttattggccaatcattttaatggcattagatttacctcttccgaaaaaggtctttgct
catggttggattttaatgaaggatggaaaaatgagtaagtcaaaaggaaacgtagtagat
ccagttacattaattgatcgttacggattagatgcattacgttattacttacttcgagaa
gttccgttcggatctgatggcgtattcacaccagaaggatttgttgaacgtatcaacttc
gatttagcaaatgacttaggtaacttattaaatcgtacagtagctatgattgataagtac
tttaacggagaaatacctgcatttaaagcaaatgtaacggaattcgatgaaacgttagta
acgtttgcaaaagatacattgcaaaaagtagaagacgcaatggaaaatatggaattctct
gtagcgctaagctcaatttggcaattggttagccgtacgaataaatatattgatgaaaca
caaccgtgggtattagcgaaggatgaaaatgatcgtgaaaagttagcttctgtaatggct
catttagcagaagtacttcgtcaaacaggtattatgcttatgccattcttaacagtagca
ccaagcaagatgtttgctcaacttggtcttactgaagaagcacataaatcttgggaaagc
ctatctataattggatgtattccaggtggaacaaaagtagaaaaaggaaatccaattttc
cctcgtttggaaatggaagtagaagtagagtatattaaagaacaaatgaagagctctgcg
cctaaagtagaagagaaaaaagaagaagaaccgcaggcagaagaaattacaattgatgat
ttctttaaagtagaattacgagtagctgaagtaatatcggctgaacctgtaaaaaaagca
gataagctgttaaaaatccagcttgatttaggtacagaaaagcgccaggttgtttcaggt
attgcaaaattctattctccggaagacttacaaggtaaaaaagttatttgtgtaacaaac
ttaaaacctgtaaaattacgcggtgaattatcacaaggtatgattttagcgggtgaagag
aatggagtattgtcattagcaacaatcgaccaaaatcttccgaatggtacaaaaatcaag
taa

DBGET integrated database retrieval system