KEGG   Bacillus thuringiensis MC28: MC28_5399Help
Entry
MC28_5399         CDS       T02263                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MC28_5399
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MC28_5399
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MC28_5399
    1.1.1.-  
     MC28_5399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C Gp_dh_N OxoDH_E1alpha_N
Motif
Other DBs
NCBI-ProteinID: AFU16821
UniProt: K0FXT2
Position
5358018..5359079
Genome map
AA seq 353 aa AA seqDB search
MFKMKALLWHNQRDVRVEEVPEPTVRPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHP
LTHVKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLV
FHGLGGDGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAV
FGCGPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTN
GLGVNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVIGILGY
RHIFPSVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagta
ccagaaccaactgtacgaccaggagcagtaaaaattaaagttaaatggtgtggtatttgc
gggacagacttgcatgaatatttagcagggccaatttttattccgacagaagagcaccca
ttaacacatgtaaaagcaccggttattttaggtcatgaatttagtggtgaggtagttgaa
attggtgaaggtgttacatctcataaagtgggagaccgcgttgttgtagaaccaatttat
tcttgtggtaaatgtgaagcttgtaaacatggacattacaatgtttgtgaacagcttgtt
ttccacggtcttggtggagacggcggtggcttctctgaatatacagtagtaccagaagat
atggttcatcatattccagatgaaatgacgtatgaacaaggtgcacttgtagaaccagca
gcagtagcagttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagcagta
tttggttgtggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaact
cctgttatcgcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcg
gattacgtattaaatccagcaactcaagatgtattagcagaaattcgtaacttaacaaac
ggtttaggtgtaaatgttagcttcgaagtaacaggtgttgaagttgtactacgtcaagca
attgaaagtacaagttttgaaggacaaacggtaattgttagcgtatgggaaaaagatgca
acaattactccgaacaaccttgtattaaaagaaaaagaagttatcggtattcttggatac
cgtcacatcttcccatctgttattaaattaattagctctggtcaaattcaagcagagaaa
ttaattacgaaaaaaattacagtggatcaagttgttgaagaaggatttgaagcacttgta
aaagataaaacacaagtgaaaattcttgtttcacccaaataa

DBGET integrated database retrieval system