KEGG   Bacillus thuringiensis MC28: MC28_F107Help
Entry
MC28_F107         CDS       T02263                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00561  Glycerolipid metabolism
btm00640  Propanoate metabolism
btm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MC28_F107
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MC28_F107
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     MC28_F107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AFU17551
UniProt: K0FZY2
Position
pMC319:complement(128908..130017)
Genome map
AA seq 369 aa AA seqDB search
MERILISPQKYIQGRNVIEKIGEYVKPLGTNLLVIADECVWHLVGEKVTGSFHKQNLSFE
KVGFNGESSENEIARIEKIGKEFGADVIIGIGGGKSVDTAKAVGEILAAKVVSVPTIAST
DAPTSSLSVIYSDDGVFEKYKFYLKNPDIILVDSQVIAQAPSRFLAAGIGDGMATWIEAR
ANLESRKPAMAGGLSTLAAAKIAELCWDTLFQYGEAALLAVKQNTVTPAVEAVIEANTLL
SGLGFESVGLAAAHAIHNGFTVLHDKTHDLMHGEKVAFGTLVQMALESWTTEELYNYIDF
CIKLGLPTTLEDLNLGDASKEELMKVAEAACQDGETIHNMPFEISPEMVFDAIIAADAYA
TEYKLKKLK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtattctaattagcccgcaaaaatatattcagggaagaaatgtaattgaaaaa
attggagagtatgtaaaacctctaggaaccaatttattagttattgcagatgaatgtgtt
tggcatcttgttggtgaaaaagttacgggaagctttcataaacaaaatctaagctttgaa
aaagtcggttttaatggtgaaagttctgaaaatgaaattgcaagaattgagaaaatagga
aaagaatttggtgctgatgtaattattggtatcggtggtggtaaatcagtagacacggca
aaagcagtaggagaaattcttgcggctaaagttgtaagcgttcccactattgcctcaaca
gatgcaccaaccagttcgctttctgttatttactctgatgatggagtatttgagaaatac
aaattttatttgaaaaatccggatattattttagtggattcccaagtcattgcacaagct
ccatccagatttttagctgctgggattggcgatggcatggctacatggattgaggctaga
gcaaatttagaatcacgaaaacctgctatggctggaggactatctaccttagcagctgct
aagattgcagaactctgctgggataccttattccaatacggggaagctgctcttttagcc
gttaaacaaaacacagttactccagcagttgaagctgtaatagaggcaaacaccttgcta
agtggacttggatttgaaagtgtagggttggctgcagctcatgctattcataatggtttt
actgttttacatgataaaactcatgatttaatgcacggcgaaaaggttgcatttggtaca
ttagtacaaatggcattggaatcttggacaactgaagaactatataactacattgatttc
tgtatcaaacttggcttacctactacacttgaagatttgaacttaggtgatgcaagtaaa
gaagaattgatgaaagttgcagaagctgcctgtcaagatggtgaaactatacataatatg
ccatttgaaatttcaccagaaatggtttttgatgcaattattgctgctgatgcttatgct
acggagtataaattaaaaaaattaaaataa

DBGET integrated database retrieval system