KEGG   Bacillus thuringiensis HD-789: BTF1_08065Help
Entry
BTF1_08065        CDS       T02411                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00480  Glutathione metabolism
btn00590  Arachidonic acid metabolism
btn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BTF1_08065
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTF1_08065
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BTF1_08065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFQ25824
Position
1565322..1565804
Genome map
AA seq 160 aa AA seqDB search
MTVYNFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKDQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKVDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttataatttttcagctaaaacaattacaggtgaagaaaaatcgttaaaagat
tacgaaggaaaagcacttcttattgtaaatgtagctagtaaatgtggtttcacaccgcaa
tataaaggattacaagaggtgtatgataaatataaagaccaaggactcgaaatactcgga
tttccttgtaaccaattcgggggacaagaaccaggtacagaagcggacattactagtttt
tgtgaattaaactacggtgtaaacttcccaatgtttgcaaaggttgatgtgaaaggtgat
aaggctcatcctttatatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtgaaatggaattttacgaagtttttaatcggaaaagacgggaaagtagtagggcgt
tttgcgccgcagacgaagccggtagatttagaggttgagattgagaaggtacttggagaa
taa

DBGET integrated database retrieval system