KEGG   Bacillus thuringiensis HD-789: BTF1_12995Help
Entry
BTF1_12995        CDS       T02411                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00010  Glycolysis / Gluconeogenesis
btn00071  Fatty acid degradation
btn00350  Tyrosine metabolism
btn00625  Chloroalkane and chloroalkene degradation
btn00626  Naphthalene degradation
btn00680  Methane metabolism
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
btn01120  Microbial metabolism in diverse environments
btn01130  Biosynthesis of antibiotics
btn01200  Carbon metabolism
btn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTF1_12995
  09102 Energy metabolism
   00680 Methane metabolism
    BTF1_12995
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTF1_12995
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BTF1_12995
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTF1_12995
   00626 Naphthalene degradation
    BTF1_12995
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTF1_12995
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     BTF1_12995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFQ26786
Position
2526906..2528039
Genome map
AA seq 377 aa AA seqDB search
MKAVTYQGPNQVQVKQVDDAKLEKKDDIIVRITSTAICGSDLHLYQGNMPLPQGYIIGHE
PMGIVEEVGPDVTKVKKGDRVVIPFNVSCGHCFYCQHEMESQCDNSNPHYDSGGYFGYTE
KFGNHPGGQAEYLKVPFGNFTPFVIPESCDLEDESLLFLSDVLPTAYWSVINAGVKPGDT
VIVLGCGPVGLMTQKFAWMQGAKRVIAVDYLDYRMNYAKKINNVEVFEFTKFPDMGEHLK
EITHGGADVVIDCVGMDGKKSPLEFLEQKLKLQGGTLGPIQIATKAVRKYGTVQMTGVYG
GNYNAFPLGAFWVRNINLKMGQAPVIHFMPELFKKITNKEFDPKEIITHKIPLEEASYGY
QIFNNREDDCIKVILKP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtaacctatcaaggaccaaatcaagtacaagttaaacaagttgatgatgca
aagttagagaaaaaagatgatattattgtaagaattacttcaaccgctatttgcggttct
gatttacatttatatcaaggtaacatgcccttacctcaaggatacattatcggccatgaa
ccaatgggaatcgttgaagaagtcgggccagatgtcactaaagtgaaaaaaggcgatcgt
gttgtcatccccttcaacgtttcttgtggacattgtttctattgccaacatgaaatggaa
agtcaatgtgataactcaaaccctcattacgattctggtggatactttggttatacggag
aaatttggtaatcatccaggcggacaagcagaatatttaaaagttccttttggaaatttc
actccatttgttataccggaatcatgcgatcttgaagatgaatccctactatttttatca
gatgttttaccaacagcctattggagtgtaataaacgcaggcgttaagccaggtgatacc
gttatcgtccttggttgtggacctgttggattaatgacacaaaaatttgcctggatgcaa
ggtgctaagcgcgtaatagcagtggattacttagattatcgaatgaattacgcaaaaaag
attaacaatgttgaggtatttgagtttacaaaatttccagatatgggagaacatttaaag
gaaattacacatggcggtgccgatgtagtcattgattgcgtgggaatggatggaaaaaaa
tcgcctctagaatttctggaacaaaaattgaaactacaaggcggaactctcggccctatt
caaatcgctacgaaagccgtaaggaaatatggaacggttcaaatgactggcgtttatggt
ggcaattataatgcatttccactcggggcattttgggttagaaatattaatcttaaaatg
ggacaagcacctgtcattcattttatgccggaactatttaaaaaaataacaaataaagaa
tttgatccaaaagagattattacacacaaaatcccccttgaagaagcgagctacggttat
caaatttttaataatcgtgaagatgattgtataaaagtcattctgaagccttga

DBGET integrated database retrieval system