KEGG   Bacillus thuringiensis HD-789: BTF1_16175Help
Entry
BTF1_16175        CDS       T02411                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00071  Fatty acid degradation
btn00072  Synthesis and degradation of ketone bodies
btn00280  Valine, leucine and isoleucine degradation
btn00310  Lysine degradation
btn00362  Benzoate degradation
btn00380  Tryptophan metabolism
btn00620  Pyruvate metabolism
btn00630  Glyoxylate and dicarboxylate metabolism
btn00640  Propanoate metabolism
btn00650  Butanoate metabolism
btn00900  Terpenoid backbone biosynthesis
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
btn01120  Microbial metabolism in diverse environments
btn01130  Biosynthesis of antibiotics
btn01200  Carbon metabolism
btn01212  Fatty acid metabolism
btn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTF1_16175
   00630 Glyoxylate and dicarboxylate metabolism
    BTF1_16175
   00640 Propanoate metabolism
    BTF1_16175
   00650 Butanoate metabolism
    BTF1_16175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTF1_16175
   00072 Synthesis and degradation of ketone bodies
    BTF1_16175
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTF1_16175
   00310 Lysine degradation
    BTF1_16175
   00380 Tryptophan metabolism
    BTF1_16175
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTF1_16175
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTF1_16175
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTF1_16175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btn04147]
    BTF1_16175
Enzymes [BR:btn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTF1_16175
Exosome [BR:btn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTF1_16175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFQ27406
Position
complement(3146087..3147178)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKEYEVQQLVTPLLTFLSKGIEREIDDVMLGNIVGPGGNI
ARLSALEAGLGYHIPGVTIDRQCGASLEAIRTACHLIQGGAGKCYIAGGVESTSTSPFQK
RARFSPETIGDPDMGVAAEYVAERYNITREMQDEYACLSYKRTLQALEKGYIHDEIFSFN
GLLDESIKLEMNYERIIKRTKPAFLQNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPKLPGTGPIFAVNKLLNEMNVKVEDIDYFEINEAFASKVVACAKELQ
IPYEKVNVNGGAIALGHPYGASGAMLVTRLFYQAQRESMKYGIATLGIGGGIGIALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaggcgaaaagaacacctatcggtaagaagaatgggatg
ttaaaagagtatgaagttcagcaattagtaacgccgcttcttacgtttttaagtaaaggg
attgagagagaaatagacgatgtcatgttagggaatattgtggggccaggagggaatatt
gcgagactatctgctttagaggcgggacttggctatcatattcctggtgtaacgattgat
cggcaatgtggtgctagtttagaagcaattcgaactgcgtgtcatctcattcaaggcggg
gcaggtaagtgttatatcgccgggggagtagagagtacaagtacgtcaccttttcaaaaa
agagcacgattttcacctgaaacaattggtgatcctgacatgggagtagcggctgaatat
gttgcggagcgttataacataacgagagaaatgcaagacgagtatgcttgtcttagttat
aagcggacactgcaagcgttagaaaaaggatatatacatgatgaaatattttcttttaat
ggattattagatgaatctataaagctagaaatgaattatgaacgaatcattaaaagaaca
aagcccgcatttttacaaaatggaacagtaacggcaggtaattcgtgcggtgtaaatgat
ggagcatgtgccgttcttgtaatggaagagggacaagcccgaaagttaggttataaacct
gtccttcgtttcgttcgtagtgctgtagtgggagtggatcccaagcttccagggactggt
ccgatatttgcggtgaacaaattattaaacgaaatgaatgtaaaagtagaggacatcgat
tattttgaaataaatgaagcattcgcctcaaaagttgttgcttgcgcaaaagagttacaa
attccgtacgaaaaagtaaatgtaaatggtggagcaattgcgctcggtcatccgtacggt
gcatctggtgctatgcttgtaacacgtttgttttatcaggcacaaagagagtctatgaaa
tatggaattgctacattaggaattgggggcgggatagggattgcgctattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system