KEGG   Bacillus thuringiensis HD-789: BTF1_18155Help
Entry
BTF1_18155        CDS       T02411                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00010  Glycolysis / Gluconeogenesis
btn00020  Citrate cycle (TCA cycle)
btn00620  Pyruvate metabolism
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
btn01120  Microbial metabolism in diverse environments
btn01130  Biosynthesis of antibiotics
btn01200  Carbon metabolism
Module
btn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTF1_18155
   00020 Citrate cycle (TCA cycle)
    BTF1_18155
   00620 Pyruvate metabolism
    BTF1_18155
Enzymes [BR:btn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BTF1_18155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: AFQ27800
Position
complement(3535768..3537054)
Genome map
AA seq 428 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAIVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAAVEAPAAEATPAATAEVVNE
RVIAMPSVRKYAREKGVDIHKVAGTGKNGRIVKADIDAFANGGQTVAATEAPAAVEATPA
AKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRK
KFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDK
GLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPTEMKGASCTITNIGSAGGQWFTPV
INHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLND
PQLLVMEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgatgaagtaaatgaagacgatgtacttcttgaagtacaa
aatgataaagcagtagtagaaatcccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggaacagttgcaatcgtaggagatacattaattaaatttgatgctcctgga
tacgaaaaccttaaatttaaaggtgacgatcatgatgaagctccaaaagctgaagaagca
gcagtagaagctccagcagcggaagctactccagcagcaactgcagaagtagtaaatgag
cgcgtaatcgctatgccatctgttcgtaaatacgctcgtgaaaaaggtgtagacattcat
aaagtagctggtactggtaagaatggccgtatcgtaaaagctgacatcgatgcatttgca
aatggtggacaaactgtagcagcaactgaggctccagcagcagtagaagctactccagca
gcgaaagaagaagcaccaaaagcacaaccaattccagctggagaatatccagaaactcgt
gagaaaatgagtggtatccgtaaagcgattgcgaaagcaatggttaactctaagcataca
gctcctcacgtaacattaatggatgaagttgatgtaactgagcttgttgctcaccgtaag
aagttcaaagcagtagcagctgacaaaggtattaaattaacttaccttccgtacgttgtt
aaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagacgatgca
tctcaagaagtagttcataaacattacttcaacatcggtatcgcagctgatacagacaaa
ggtctattagtaccagttgttaaagatacagatcgtaagtctatcttcactatttctaac
gagatcaacgatcttgctggtaaagcacgtgaaggtcgtctagctccaactgaaatgaaa
ggtgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactccagtt
atcaatcacccagaagtagcaatccttggtatcggccgtatcgctgaaaaaccagttgtg
aaaaatggcgagatcgttgcagctccagtattagcattatctctaagctttgaccatcgt
ttaattgacggcgcaacagctcaaaaagcgttaaaccaaattaaacgtctattgaatgac
ccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system