KEGG   Bacillus thuringiensis HD-789: BTF1_21025Help
Entry
BTF1_21025        CDS       T02411                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00471  D-Glutamine and D-glutamate metabolism
btn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BTF1_21025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btn01011]
    BTF1_21025
Enzymes [BR:btn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BTF1_21025
Peptidoglycan biosynthesis and degradation proteins [BR:btn01011]
 Precursor biosynthesis
  Racemase
   BTF1_21025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AFQ28374
Position
complement(4060656..4061459)
Genome map
AA seq 267 aa AA seqDB search
MNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHL
LDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYQVGIIGTIGTV
KSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKSTDIDTLI
LGCTHYPILGPVIKKVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTTGK
IGLFKEIASKWFGQPIENVKHIHLEKE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagagcaatcggtgttatcgattcaggagttggcggtttaacagtagcgaaggaa
ttaattcgtcagttgccgaaagagcgtatcatatatttaggagatacagcacgttgtcct
tatggtccacgttctcgagaagaagtgcgtcaatttacgtgggaaatgacggagcattta
ctagatttaaatattaaaatgttagttattgcgtgtaatacagcaactgcagttgtatta
gaagagatgcaaaaacaattaccaattccagtagtaggagttattcacccaggatcacgt
acagctttaaaagtgacaaacacgtatcaggttgggattattggaacgattggaaccgtg
aaaagtggtgcatacgaagaggcgttaaagtctattaataaccgtgttatggtagaaagt
ttagcttgtccacctttcgttgaacttgtagagagtgggaatttcgaaagtgaaatggcg
tacgaagttgtaagagaaacgctgcaaccactgaaaagtaccgatattgatacccttata
ttagggtgtacacattatccgattttaggacctgttattaaaaaagtaatgggagataaa
gtacaactaattagttctggtgatgaaacagcacgtgaagtaagtacaatcttatatcat
agtaaaatgttgaatgaaggagaagaacaaagcgatcatctcttcttaacaacaggaaaa
ataggcttgtttaaagaaattgcatcaaaatggttcggtcaaccgattgaaaatgtgaag
catattcatttagaaaaagaataa

DBGET integrated database retrieval system