KEGG   Bacillus thuringiensis HD-789: BTF1_23120Help
Entry
BTF1_23120        CDS       T02411                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00040  Pentose and glucuronate interconversions
btn00052  Galactose metabolism
btn00500  Starch and sucrose metabolism
btn00520  Amino sugar and nucleotide sugar metabolism
btn01100  Metabolic pathways
btn01130  Biosynthesis of antibiotics
Module
btn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTF1_23120
   00052 Galactose metabolism
    BTF1_23120
   00500 Starch and sucrose metabolism
    BTF1_23120
   00520 Amino sugar and nucleotide sugar metabolism
    BTF1_23120
Enzymes [BR:btn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BTF1_23120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFQ28791
Position
complement(4456381..4457268)
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPETETHRYGIIDPLEQEG
RRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILEEQANQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gcaacgaaagcaatgccgaaagaaatgttaccgatagtagataaaccaacgattcaatac
attgtagaagaagcagtgaaatcgggaatcgaagatattattatcgttactggtaaaaca
aagcgctctatcgaagatcattttgataacgcatttgaactagaacaaaacttattagag
aagaaaaaatatgagttgcttgaaaaagtacaagcttcttcaaaaatggtagatattcat
tacatccgtcaaaaagagccgaagggactaggacatgctgtttggtgtgcacgtaaattc
attggtgatgagccatttgcagtgttactaggtgatgatattgtccaagctgagaaacca
tgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgtacaa
actgttccagaaacagaaacacaccgttacggaattatcgatccattagaacaagaaggt
cgtcgttaccaagttcgcaatttcgttgagaaaccagcacaaggtacagcaccttcaaac
ttagcgattatgggccgttacattttaacgcctgaaatctttatgttcttagaacagcaa
catgtcggtgctggtggtgaaattcagttaacagatgcaatccaaagcttaaatgaaatc
caacgtgtatttgcttacgatttcgaaggaaagcgctacgatgtaggtgaaaagctagga
ttcgttcaaacgacaattgaaatggccctgcaacacccagaattacgtgatgacatggtt
gcgatgatgaagaaaattttagaagaacaagcgaatcaagagtcttaa

DBGET integrated database retrieval system