KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_14310Help
Entry
WQG_14310         CDS       T02504                                 

Definition
(GenBank) Oxygen-independent coproporphyrinogen-III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00860  Porphyrin and chlorophyll metabolism
bto01100  Metabolic pathways
bto01110  Biosynthesis of secondary metabolites
Module
bto_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WQG_14310
Enzymes [BR:bto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     WQG_14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C GFRP
Motif
Other DBs
NCBI-ProteinID: AGH38708
UniProt: M4R961
Position
complement(1580472..1581839)
Genome map
AA seq 455 aa AA seqDB search
MSEIIWDIDLIQKYNQSGPRYTSYPTALEFNESYNDDDFKAAAARYPDKPLSLYVHIPFC
HKLCYFCACNKIITRHQHKVDIYLDYLEKEIIYRSALFKNRQVSQIHWGGGTPTYLDEAQ
SERLMTMLKTHFNVRDDAEISIEMDPREIELDMLDHLRKIGFNRISMGIQDFNKEVQKLV
NREQDEEFIFALMKRAKELGFDSTNIDLIYGLPKQTVDSFMFTLEKVVELNPDRMSVFNY
AHLPSRFAAQIKIKDEMLPAPSTKLDILQQTIEKLGNSGYQFIGMDHFAKPDDELAIAQA
KGELHRNFQGYTTQEDADLLGMGVSAISILGDSYAQNHKELKQYYTEVEMRGIALHKGLM
LTKDDCIRRDVIKGLICNFKLDYALVEKQYSIEFKHYFAEDLALLQPLVKDGLLDINDND
IVVSPRGRLLIRNICMCFDIYSRQQAKRQQFSRII
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagattatctgggatattgatctcattcaaaaatacaaccagtcaggtcctcgc
tatacgtcttatccgacagcgttggaatttaacgaatcttataacgatgatgatttcaaa
gcggcagcagctcgttatccagataagccgctttcgctttatgtgcatattccattttgc
cataagctttgttatttctgcgcatgtaataaaattattacccgtcatcagcataaagta
gatatttatctcgattatttggaaaaagagatcatctatcgctctgcgttattcaaaaat
cgccaagtaagtcaaattcactgggggggcggtacgccgacctatttagacgaagcccaa
tctgagcgtttaatgacaatgctgaaaacgcattttaatgtgcgtgatgatgctgaaatt
agtattgaaatggatccgcgggaaattgaactagatatgctggatcacttacgcaaaatc
ggctttaaccgtatcagtatggggatacaggatttcaataaagaagtgcagaaattagta
aaccgtgaacaagatgaagagtttattttcgctttaatgaaacgggcgaaagagttaggt
tttgattcgacgaatattgatttaatttacggcttaccaaaacagacggttgatagtttt
atgtttactttggagaaagtggtggagcttaatcctgatcgcatgagtgtatttaactat
gcccacttaccaagccgttttgccgcacagatcaaaattaaagatgagatgctgccagca
ccttcgactaaacttgatattctacagcagacgatcgaaaagctgggaaattcaggttac
caattcattggtatggatcactttgccaaacctgatgatgaattagctattgcacaagca
aaaggtgagctgcaccgcaatttccaaggttatactacccaagaagatgccgatttactt
ggtatgggggtgtctgcaatcagtattcttggcgatagctatgcgcaaaaccacaaagag
ttgaaacagtactatactgaagtggaaatgcggggcattgcgctacataaaggcttgatg
ctgacgaaagacgattgtattcgccgtgatgtaattaaaggcttaatttgtaatttcaaa
ttagattatgcgctggttgaaaaacagtattcaatcgaatttaaacactattttgctgag
gatttggctttacttcaaccgcttgtaaaagatggtttattagatatcaatgataatgat
attgtcgtttctcctcgtgggcgtttgcttattcgcaatatctgtatgtgttttgatatt
tattcaagacaacaagcgaaaaggcagcagttttctcgaattatttaa

DBGET integrated database retrieval system