KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_20940Help
Entry
WQG_20940         CDS       T02504                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bto00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    WQG_20940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bto03011]
    WQG_20940
Ribosome [BR:bto03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    WQG_20940
  Bacteria
    WQG_20940
  Archaea
    WQG_20940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733 TetR_C_22
Motif
Other DBs
NCBI-ProteinID: AGH39371
UniProt: M4R876
Position
complement(2242354..2242686)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADVDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaaacatcgttacgctcgtacttctgcccaaaaagctcgcttagtt
gctgatttaattcgcggtaaaaaagttgcgcaagcactagaaatcttaactttcactaac
aaaaaagcagcagcgcttgttaagaaagtattagaatcagctattgcaaacgcagagcac
aatgacggtgcagatgtcgatgatcttaaagttgctaaaatcttcgttgatgaaggtcca
agcatgaaacgtgtaatgccacgtgctaaaggtcgtgcagatcgtattttaaaacgtact
agccacatcactgtggtagtatcggatcgttaa

DBGET integrated database retrieval system