KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_21490Help
Entry
WQG_21490         CDS       T02504                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00471  D-Glutamine and D-glutamate metabolism
bto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WQG_21490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bto01011]
    WQG_21490
Enzymes [BR:bto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     WQG_21490
Peptidoglycan biosynthesis and degradation proteins [BR:bto01011]
 Precursor biosynthesis
  Racemase
   WQG_21490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AGH39426
UniProt: M4R8D1
Position
2297622..2298410
Genome map
AA seq 262 aa AA seqDB search
MKPTILLYDSGMGGLTIYDALRQVLPSAHYLYCFDNAYFPYSEKPEKVLIARAVEIVQKI
AQKYPLDLVVVACNTASTVVLPALRQTFDLPIVGTVPAIKPAAQISQTKTIGLLATKGTV
SRPYVDELIAKYAADCRVEKIGTTDLVEIVEEKQRTGKVDMARLQTVVQAWQHHPTLDTV
ILGCTHFPLVKNELQQLLPKVPFFVDPNNGIAHRVQALLQGKRFENKENLQNVAFCTAHD
ADFLSQNQIMQTWGFAKLQVLD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaccattctgctgtatgattcaggtatgggcgggctgaccatctatgacgca
ctccgccaggtgctaccaagcgcacattatctctattgctttgataatgcttatttccct
tattcagaaaaaccagaaaaggtgctgattgctcgtgcagtcgagattgtgcaaaaaatt
gcgcaaaaatacccgcttgatctggtcgttgtcgcgtgtaataccgccagtaccgtagta
ttacctgccttacggcaaacgtttgatcttcccatagtaggcaccgtgccggcaattaaa
ccggctgcacaaatttcacaaaccaaaacgatcggcttactcgcaacaaaaggcactgtc
tctcgcccctatgtggatgagctcatcgctaaatatgcagccgactgccgagttgaaaaa
attggaacgaccgatttagtagagattgtggaagaaaagcaacgcacgggtaaagtggat
atggcacgtttgcaaaccgtggtgcaagcatggcaacaccatccgacactggataccgtc
attttaggctgtactcactttccgttagtcaaaaatgagttgcaacagctgctacccaaa
gtgccattctttgtcgatcccaataacggtattgcccatcgcgtgcaagcactcttgcaa
ggcaagcggtttgaaaataaagaaaatttgcaaaatgttgcgttttgcactgcacatgat
gcagatttcttaagccaaaaccagattatgcaaacatggggcttcgctaaattgcaggtt
ttagattaa

DBGET integrated database retrieval system