KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_6690Help
Entry
WQG_6690          CDS       T02504                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Brite
KEGG Orthology (KO) [BR:bto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bto03009]
    WQG_6690
Enzymes [BR:bto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     WQG_6690
Ribosome biogenesis [BR:bto03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    WQG_6690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AGH37948
UniProt: M4R733
Position
707064..708041
Genome map
AA seq 325 aa AA seqDB search
MAQQITLTAEVTSDLLGARLDQALAQLFPDYSRSRLKVWIENDLVTVNGKIVNKAREKVF
GGELIEVQAETEEEIRFEPQDIPLNIVYEDDDILVINKPKDLVVHPGAGNPDGTVLNALL
HHYPQIVEVPRAGIVHRLDKDTTGLMVVAKTLPAQTHLVSALQKRQITREYEAVASGIMT
QGGKVDEPMARHPTKRTAMAVHPMGKPAVTHYRIMERFRNYTRLRLRLETGRTHQIRVHM
AHIAHPLLGDQLYGGRPRPPKGASEEFLEVLRNFKRQALHAAMLRLEHPITGELMEWHAP
LPDDFIALIQALKADYNLYKDELDY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacaaattactttaacagccgaagtaacttcggatttactaggtgccagactt
gatcaggcattagcacaactttttcctgattattcacgttcgcgtttgaaagtgtggatt
gaaaatgatctggttacagtgaatggcaaaattgtcaataaagcgcgagaaaaagtcttt
ggtggtgaattaattgaagtgcaggcggaaacagaagaagaaatccgctttgaacctcag
gatattccactcaatattgtttatgaagacgatgatattttagtgatcaataaaccaaaa
gatcttgtggttcaccctggggcgggtaatccagatggtacagtgctaaatgctttattg
catcactacccacaaatcgttgaggtgccacgtgcagggattgtgcatcgtttagataaa
gataccacgggcttaatggtggttgcaaaaacgttaccagcacaaacgcatttagtctcc
gcgctacaaaaacgtcaaattacccgtgagtatgaggcggtcgccagtggtattatgact
caaggagggaaagtggatgaacccatggctcgccatcctaccaaacgtactgcaatggct
gttcatccaatgggtaagcctgccgttacgcattaccgtattatggagcgttttcgcaat
tacacacgtttacgtttacgcttagaaacagggcgtacgcaccaaattcgtgtgcatatg
gcacatattgctcatccattacttggtgatcagctttacggtggaagacctcgccctccc
aaaggtgccagtgaagaatttttggaagtgttacgtaatttcaaacgccaagctttacat
gcagcaatgttgcgtttagaacatccaattaccggcgaattgatggagtggcatgcacca
ctgcctgatgattttatagcattaatccaagcattaaaggcggattataacttgtataaa
gatgagttagattattaa

DBGET integrated database retrieval system