KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_8670Help
Entry
WQG_8670          CDS       T02504                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00071  Fatty acid degradation
bto00072  Synthesis and degradation of ketone bodies
bto00280  Valine, leucine and isoleucine degradation
bto00310  Lysine degradation
bto00362  Benzoate degradation
bto00380  Tryptophan metabolism
bto00620  Pyruvate metabolism
bto00630  Glyoxylate and dicarboxylate metabolism
bto00640  Propanoate metabolism
bto00650  Butanoate metabolism
bto00900  Terpenoid backbone biosynthesis
bto01100  Metabolic pathways
bto01110  Biosynthesis of secondary metabolites
bto01120  Microbial metabolism in diverse environments
bto01130  Biosynthesis of antibiotics
bto01200  Carbon metabolism
bto01212  Fatty acid metabolism
bto02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WQG_8670
   00630 Glyoxylate and dicarboxylate metabolism
    WQG_8670
   00640 Propanoate metabolism
    WQG_8670
   00650 Butanoate metabolism
    WQG_8670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WQG_8670
   00072 Synthesis and degradation of ketone bodies
    WQG_8670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WQG_8670
   00310 Lysine degradation
    WQG_8670
   00380 Tryptophan metabolism
    WQG_8670
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WQG_8670
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WQG_8670
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WQG_8670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bto04147]
    WQG_8670
Enzymes [BR:bto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WQG_8670
Exosome [BR:bto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WQG_8670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C SpoVAD Ketoacyl-synt_C ZoocinA_TRD
Motif
Other DBs
NCBI-ProteinID: AGH38144
UniProt: M4R8R6
Position
936036..937217
Genome map
AA seq 393 aa AA seqDB search
MKNIVIASAVRTAIGSFGGSLAGVSAVELGTTVIKSAIERAGLDMTKVDEVIMGNVLQAG
LGQNPARQALLRAGIAQEVPAYTVNKVCGSGLKAVALAAQAIKAGDANIIIAGGMENMSQ
APYLLDSKSRWGYRLGDGKVQDVILSDGLMCAENHYHMGITAENVAKKYGITRQMQDELA
LSSQQKATAAIQSGAFKNEIIPMNVKIKRKEVVFDTDEFVKQDSTLEGLSSLRTAFDKEG
TVTAGNASGINDGAAALVVVEEETAKALGLNILARIKGYASGGVAPDIMGMGPVPATQNA
LKKAGLTLNDIDLIEANEAFAAQFLAVGKELGFNPEKVNVNGGAVALGHPIGASGARILV
TLLHAMHARDKQFGLATLCIGGGQGIAMIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagttattgcaagtgcggtgcgcaccgcaatcggcagtttcggtggttct
ttagcaggggtttcggcagtggaactcggcacaacagtaatcaaatctgcgattgagaga
gccggtttagacatgactaaagtagatgaagtgattatggggaatgtgcttcaggccgga
cttgggcaaaaccctgcccgccaagcgttattacgcgcaggtattgcccaagaagtcccc
gcttatacagtaaacaaagtatgtggttcaggtttaaaggctgtggcacttgctgctcaa
gcaattaaagccggtgatgcaaatatcatcatcgctggcggtatggaaaatatgagccaa
gcaccgtacttgttagattctaagtcacgctggggctatcgtttaggcgatggcaaagta
caagatgtgattttatccgatggcttaatgtgtgcagaaaatcactaccatatggggatt
acggcagaaaatgttgccaaaaaatatggtattacccgccaaatgcaggatgaattggca
ctttcctctcagcaaaaagccactgctgccattcaatcaggtgcattcaaaaatgaaatc
ataccaatgaatgtaaaaattaaacgcaaggaagtggtttttgataccgatgagtttgta
aaacaagattcaactcttgaaggtttatcttcacttcgtactgcgtttgataaagaagga
acagttaccgcagggaatgcttcaggtattaacgatggcgctgctgcattagtggtggtc
gaagaagaaacagcaaaagcattgggattaaacattcttgcgcgtattaaaggctatgca
agtggtggggttgcgccagatattatgggcatggggcctgttcctgcaacacaaaatgcg
ctgaaaaaagcaggcttaaccttaaacgacattgatctcattgaagctaatgaagcattt
gcggcacagttcttagcggtgggtaaagagttaggttttaaccctgaaaaagtcaatgta
aacggtggtgcagtagctctaggtcaccctatcggtgcaagtggtgcgcgcatcttagtc
actttattacacgcaatgcatgcccgtgataaacaattcggtttagcaacgctttgtatc
ggtggtggacaaggcattgccatgatcgttgaacgtatttaa

DBGET integrated database retrieval system