KEGG   Burkholderia thailandensis 2002721723: BTQ_1648Help
Entry
BTQ_1648          CDS       T03111                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq00010  Glycolysis / Gluconeogenesis
btq00053  Ascorbate and aldarate metabolism
btq00071  Fatty acid degradation
btq00280  Valine, leucine and isoleucine degradation
btq00310  Lysine degradation
btq00330  Arginine and proline metabolism
btq00340  Histidine metabolism
btq00380  Tryptophan metabolism
btq00410  beta-Alanine metabolism
btq00561  Glycerolipid metabolism
btq00620  Pyruvate metabolism
btq00625  Chloroalkane and chloroalkene degradation
btq00903  Limonene and pinene degradation
btq01100  Metabolic pathways
btq01110  Biosynthesis of secondary metabolites
btq01120  Microbial metabolism in diverse environments
btq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTQ_1648
   00053 Ascorbate and aldarate metabolism
    BTQ_1648
   00620 Pyruvate metabolism
    BTQ_1648
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTQ_1648
   00561 Glycerolipid metabolism
    BTQ_1648
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTQ_1648
   00310 Lysine degradation
    BTQ_1648
   00330 Arginine and proline metabolism
    BTQ_1648
   00340 Histidine metabolism
    BTQ_1648
   00380 Tryptophan metabolism
    BTQ_1648
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTQ_1648
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTQ_1648
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTQ_1648
Enzymes [BR:btq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BTQ_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: AHI72657
Position
1:complement(1882658..1884094)
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWHPSTGKGTIDVIDSGTEAVIGRIPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLRKITDNLKARSEDLAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEPVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEIAPLNAF
ILAEAIHDAELPAGVFNLVCGYGPVVGEALASDPEVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARELAK
AAAESYVAGDPRDDATRLGALASSAQQKRVQDYIRRGIDEGAELVTGGLGMPEGIARGFF
VKPTVFGRVKPDATIAQEEIFGPVLSIITYRDEADAVRIANDSPYGLGGAVWSGSDERAM
RIARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLEEYLEYKSMQLRPKKGA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctatatcggcggcgcgtggcacccgagcacgggcaagggc
acgatcgacgtgatcgactcgggcaccgaggccgtgatcggccgcattcccgaaggcacc
gccgaagacgcgaaagcggccgtcgccgccgcgcgcgcggcgttcgacggctgggcggcg
acgccgcccgccgagcgcgctcgctatctgcgcaagatcaccgacaacctgaaggcgcgc
agcgaggacctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggttggcggtccgatctataactggggcgcgtatgcgaagctcgccgagacg
ttcgcgttcgaggagccggtcggcaattcgctcgtcgtgcgcgagcccgttggtgtcgtc
gcggcgatcacgccatggaactacccgctcaaccagatcacgctgaaggtcgccgccgca
ctcgcggcgggctgcacggtcgcgctgaagccgtcggagatcgcgccgctcaatgcgttc
atcctcgccgaggcgattcatgacgcggagctgcccgccggcgtgttcaatctcgtgtgc
ggttacgggcccgtcgtcggcgaggcgctcgcgagcgatcctgaggtggacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgagctgggcggcaagtcggcctcggtgattctcgacgacgccgacttc
gcggccgcggtgaagggcacggtgtccgcgtgctacctgaacgcgggccagacgtgctcc
gcgcatacgcggatgctcgtgccggaatcgcgctatgaagaagcacgcgagctcgcgaag
gccgccgcggaaagctatgtcgcaggcgatccgcgcgacgacgcgacgcggcttggcgcg
ctcgcgtcgtcggctcagcaaaagcgcgtgcaggattacatccggcgcggcatcgacgag
ggcgccgagctcgtcacgggcggcctcggcatgcccgaaggcatcgcacgcggcttcttc
gtgaagccgaccgtgttcggccgcgtgaagcccgacgcgacgatcgcgcaggaagaaatc
ttcggtccggtgctgtcgatcatcacgtatcgcgacgaggccgacgcggtgaggatcgcg
aacgattcgccgtacggcctcggcggcgcggtgtggtcgggcagcgacgagcgcgcgatg
cgcatcgcgcgccgcattcgcacggggcaggtcgacatcaacggcggagcctggaacatg
gccgcgccgttcggcggtttcaaacagtcggggatcggtcgcgagaacggcgtgtacggg
ctcgaagaatatctcgaatacaaatcgatgcaattgcggccgaagaagggcgcgtga

DBGET integrated database retrieval system