KEGG   Burkholderia thailandensis 2002721723: BTQ_1663Help
Entry
BTQ_1663          CDS       T03111                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq00071  Fatty acid degradation
btq00072  Synthesis and degradation of ketone bodies
btq00280  Valine, leucine and isoleucine degradation
btq00310  Lysine degradation
btq00362  Benzoate degradation
btq00380  Tryptophan metabolism
btq00620  Pyruvate metabolism
btq00630  Glyoxylate and dicarboxylate metabolism
btq00640  Propanoate metabolism
btq00650  Butanoate metabolism
btq00900  Terpenoid backbone biosynthesis
btq01100  Metabolic pathways
btq01110  Biosynthesis of secondary metabolites
btq01120  Microbial metabolism in diverse environments
btq01130  Biosynthesis of antibiotics
btq01200  Carbon metabolism
btq01212  Fatty acid metabolism
btq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTQ_1663
   00630 Glyoxylate and dicarboxylate metabolism
    BTQ_1663
   00640 Propanoate metabolism
    BTQ_1663
   00650 Butanoate metabolism
    BTQ_1663
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTQ_1663
   00072 Synthesis and degradation of ketone bodies
    BTQ_1663
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTQ_1663
   00310 Lysine degradation
    BTQ_1663
   00380 Tryptophan metabolism
    BTQ_1663
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTQ_1663
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTQ_1663
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTQ_1663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btq04147]
    BTQ_1663
Enzymes [BR:btq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTQ_1663
Exosome [BR:btq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTQ_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHI72704
Position
1:complement(1902606..1903787)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGVTAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRYGVTAESLASLKPAFAKDG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgaccgtgatccgcgcggtgctcgagcgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctcggccaggtgctgacggcgggc
tcgggccagaatccggcgcgtcaggcgctcatcgcggcggggctgccgaacgccgtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgctcgccgcgaac
gcgatcgtcgcgggcgacgcggagatcgtcgttgcgggcgggcaggagaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagcttgtc
gacagcatgatcgtcgacggcctgtgggacgtctacaacaagtaccacatgggcgtcacg
gcggagaacgtcgcgaaggagtacgggatcacgcgcgaagcgcaggaccagttcgcggcg
ctgtcgcagaacaaggcggaagccgcgcagaaagccggccgtttcgacgacgagatcgtg
ccgatcgagatcccgcagcgaaagggcgagccgcttcgcttcgcgaccgacgagttcgtg
cgctacggcgtgacggccgagtcgctcgcgagcctgaagcccgcgttcgcgaaggacggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tctgcgaagaaggccgaggcgctcggtctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcatcgcgccgctgt
ctcgaacgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggtccacaagcagatgggctgggatacgtcgaaggtcaacgtg
aacggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgcaaaagcgcgatgcgaaacgcggcctcgcgtcgctttgcatc
ggcggcggaatgggcgtcgcgctcgcgctcgagcgcccgtaa

DBGET integrated database retrieval system