KEGG   Burkholderia thailandensis 2002721723: BTQ_1866Help
Entry
BTQ_1866          CDS       T03111                                 

Gene name
pcp
Definition
(GenBank) pseudomonalisin
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
Organism
btq  Burkholderia thailandensis 2002721723
Brite
KEGG Orthology (KO) [BR:btq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btq01002]
    BTQ_1866 (pcp)
Enzymes [BR:btq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     BTQ_1866 (pcp)
Peptidases [BR:btq01002]
 Serine Peptidases
  Family S53
   BTQ_1866 (pcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: AHI71875
Position
1:complement(2124419..2126308)
Genome map
AA seq 629 aa AA seqDB search
MTSRKWAGLRAPQTKHAICAATLFAATTLSAHAAAPAWVDTQTRAYPAFPQQARAASQAS
AAASAAGKAIDAAPGEPVRVVVSLNLNDEAKLDRFLLDLHTPGSAAYGRPLTPAEFTARH
APTPQQVALVEAHLRRAGFRDIEVSPNRLLISATGTAAAVKTAFNTRLKRFTLEGRRVYA
NQDAAQVPAELGRIVGAVLGLDNATLARTYNRQAAVTGTVGGAKASLAARASDATAAASG
TPVLTGHDPLEFSRIYRAGATPTASLTTVGVIMAGDAAPVLRDLDTFAAKAGLARVAATV
TRTGPPGSDYNDNSGLSEWDMDSQAIVGAAGGEVKGIVFYAAPSMLLSDITEAYNRAVAD
NVAKVINVSLGVCEADARASGTQAADDRIFKSAVAQGQTFVVAAGDAGAYECSVSRVSGG
QGVPARSNYSVSEPATSPYVVAVGGTTLSTDKTTLAYAGEVAWNEGLQPIGVYDAYGSYD
GTQRLWATGGGYSKNEAVPAWQRSVLGASARTRALPDVAFDADGRSGAHVYVNGRTEQWG
GTSLAAPIFTGIWARVQSDNGNRLGFPLASLYRYVPSNRALARDVKSGHNGSGGYGYKAG
AGWDPVTGFGSLDVANFAAFVKKTADFAR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaagaaaatgggccgggcttcgtgctccgcaaacgaagcacgcgatttgcgcg
gcgacgctttttgccgcgacgacgttgagcgcgcacgcggcggcgccggcgtgggtcgac
acgcagacccgcgcttatccggcatttccgcagcaggcgcgtgccgcgtcgcaggcttcg
gcagcggcgtctgcggctggaaaggcgatcgacgcggcgcccggcgagccggtgcgcgtt
gtcgtcagtctcaatctcaacgacgaagcaaagctcgatcgcttcctgctcgatctgcat
acccccggcagcgccgcttacggccggcccctcacgcccgccgaattcaccgcgcggcat
gcgccgacgcctcaacaggtcgcgctcgtcgaagcgcatctgcgccgggccgggttccgc
gacatcgaggtgtcgccgaaccggctgctgatctcggcgacgggcaccgcggccgcggtc
aagacggcgttcaacacgcggctcaagcgcttcacgctcgagggccggcgcgtctacgcg
aaccaggacgcggcgcaggtgcccgccgagctcggccggatcgtcggcgccgtgctcggg
ctcgacaacgcgacgctcgcgcgcacgtacaaccgccaggcggcggtgacgggcacggtc
ggcggcgcgaaggcgtcgcttgccgcgcgcgcgagcgacgcgacggcggccgcgagcggc
acgcccgtgctgacgggccacgatccgctcgaattctcgcgaatctaccgcgcgggcgcg
acgccgacggcttcactgacgacagtcggcgtgatcatggcgggcgacgcggcacccgtg
ctgcgggatctcgacacgttcgcggcgaaggcggggctcgcgcgcgtcgcggcgaccgtc
acacgcaccgggccgccgggcagcgactacaacgacaattcgggcctgagcgaatgggat
atggacagccaggcgatcgtcggcgcggcgggcggcgaagtgaagggaatcgtgttctac
gcggcgccttcgatgctgctctccgacatcaccgaagcgtacaaccgcgcagtcgcggac
aatgtcgcgaaggtgatcaacgtgtcgctcggcgtgtgcgaggcggatgcgcgcgcatcc
ggcacgcaggcggcggatgaccggatcttcaagagcgcggtcgcgcaggggcagacgttc
gtcgtcgcggcgggcgacgcgggcgcgtacgaatgcagcgtgagccgcgtgtcgggtggc
cagggcgtgccggcgcgctcgaactactcggtcagcgagcccgcgacgtcgccgtacgtc
gtcgcggtcggcggcacgacgctgtcgaccgacaagacgacgctcgcgtatgcgggcgaa
gtcgcgtggaacgagggcttgcagccgatcggcgtgtacgacgcgtacggcagctacgac
ggcacgcagcgtctttgggcgacgggcggcggttacagcaagaacgaagcggtgccggcg
tggcagcgaagcgtgctcggcgcgtcggcgagaacgcgcgcgctgcccgacgtcgcgttc
gatgcggacggccgcagcggcgcgcacgtctatgtgaacggccggactgagcaatggggc
ggcacgagcctcgcggcaccgatcttcacgggcatctgggcgcgcgtgcaatccgacaac
ggcaaccggctcggctttccgctcgcgagcctctatcgctacgtgccgtcaaaccgcgcg
cttgcgcgcgacgtgaaatccggccacaacggttcgggcggctacggctacaaggcgggc
gcgggctgggacccggtgacgggcttcggcagcctcgacgtcgcgaacttcgccgcgttc
gtgaagaagacggccgatttcgcgcgataa

DBGET integrated database retrieval system