KEGG   Burkholderia thailandensis 2002721723: BTQ_2144Help
Entry
BTQ_2144          CDS       T03111                                 

Definition
(GenBank) amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BTQ_2144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btq02000]
    BTQ_2144
Transporters [BR:btq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BTQ_2144
   Histidine transporter
    BTQ_2144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 GP52 Pox_LP_H2
Motif
Other DBs
NCBI-ProteinID: AHI74468
Position
1:complement(2455318..2456007)
Genome map
AA seq 229 aa AA seqDB search
MFLYGFGPLIWAGTVQTIELSVLSLAAAVLLGLAGAVAKLSRNRVLRAGATAYTTLIRSV
PDLVLMLLLFYSIQIWLNQLTDLMNWEQIDIDPFVAGVLTLGFIYGAYFTETFRGAFLAV
PRGQLEAGSAYGMSGMRVFARIMFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTFNMFFFILVAALVYLAITTASNLVLKQLEKRYSIGVRHAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctatacggctttggtccgctcatctgggcgggcaccgtgcagacgatcgagctg
tcggtgctgtcgctcgcggcggcggtgctgctcggcctcgccggtgcagtcgcgaagctc
tcgcgcaatcgcgtgttgcgcgcgggcgcgacggcctacacgacgctcatccgctcggtg
cccgatctcgtgctgatgctgctgctgttctacagcatccagatctggctcaaccagctc
accgacctgatgaactgggagcagatcgacatcgatccgttcgtcgccggcgtgctcacg
ctggggttcatctatggcgcgtatttcaccgagacgtttcgcggcgcgttcctcgcggtg
ccgcgcggacagctcgaggcgggcagcgcgtacgggatgagcgggatgcgcgtgttcgcg
cggatcatgtttccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaggcgacggcgctcgtgtcgatcatcggtctcgccgacgtcgtgaaagcc
gcgcaggacgcgggcaaaagcacgttcaacatgttcttcttcattctcgtcgcggcgctc
gtctatctggcgatcacgacggcctccaatctcgtgctcaagcagctcgagaagcgttat
tccatcggcgtgaggcacgcggaactatga

DBGET integrated database retrieval system