KEGG   Burkholderia thailandensis 2002721723: BTQ_683Help
Entry
BTQ_683           CDS       T03111                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq00010  Glycolysis / Gluconeogenesis
btq00030  Pentose phosphate pathway
btq00051  Fructose and mannose metabolism
btq00680  Methane metabolism
btq00710  Carbon fixation in photosynthetic organisms
btq01100  Metabolic pathways
btq01110  Biosynthesis of secondary metabolites
btq01120  Microbial metabolism in diverse environments
btq01130  Biosynthesis of antibiotics
btq01200  Carbon metabolism
btq01230  Biosynthesis of amino acids
Module
btq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTQ_683 (fba)
   00030 Pentose phosphate pathway
    BTQ_683 (fba)
   00051 Fructose and mannose metabolism
    BTQ_683 (fba)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BTQ_683 (fba)
   00680 Methane metabolism
    BTQ_683 (fba)
Enzymes [BR:btq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BTQ_683 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AHI72371
Position
1:784701..785765
Genome map
AA seq 354 aa AA seqDB search
MPLVSMRQLLDHAAENGYGLPAFNVNNLEQVQAIMAAADEVGAPVIMQASAGARKYAGEA
FLRHLIEAAVESYPHIPVVMHQDHGQSPAVCMAAIRSGFTSVMMDGSLEADGKTVASYEY
NVDVSRKVVEMAHSIGVTVEAELGVLGSLETMKGDKEDGHGAEGTMTREQLLTDPEQAAD
FVKLTQCDALAIAIGTSHGAYKFTKKPTGDILSIQRIKEIHARIPNTHLVMHGSSSVPQD
LLAEIREFGGDMKETYGVPVEEIQEGIKHGVRKVNIDTDLRLAITGAIRRYMFENPGKFD
PRDYLKPAREAAKKICVARYLAFGCEGQAAKIKPVPLEKIAEKYKAGDLAQVVR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgtatcaatgcgtcaactgctggatcacgccgcggagaacggctacggcctg
cccgcgttcaacgtgaacaacctggagcaggtgcaggcgatcatggcggccgcggacgaa
gtcggcgcgcccgtgatcatgcaggcgtcggcgggcgcccggaagtacgcgggcgaggcg
ttcctgcgccacctgatcgaagcggcggtcgagtcgtacccgcacattcccgtcgtgatg
caccaggatcacggccagtcgcccgccgtctgcatggcggcgattcgcagcggcttcacg
agcgtgatgatggacggctcgctcgaggccgacggcaagacggtcgcgtcgtacgaatac
aacgtcgacgtgtcgaggaaggtcgtcgagatggcgcactcgatcggcgtgacggtcgag
gccgagctcggcgtgctcggctcgctcgagacgatgaagggcgacaaggaggacggccac
ggcgcagaaggcacgatgacgcgcgagcaactgctgaccgatcccgagcaggcggccgat
ttcgtcaagctcacgcagtgcgacgcgctcgcgatcgcgatcggcacgtcgcacggcgcg
tacaagttcacgaagaagccgacgggcgacatcctgtcgatccagcggatcaaggaaatc
cacgcgcgcatcccgaacacgcacctcgtgatgcacggctcgtcgtcggtgccgcaggac
ctgctcgcggaaatccgcgaattcggcggcgacatgaaggaaacctacggcgtgcccgtc
gaggaaatccaggaaggcatcaagcacggcgtgcgcaaggtcaacatcgacaccgacctg
cgtctcgcgatcacgggcgcgatccgccgctacatgttcgagaatcctggcaagttcgat
ccgcgcgattacctgaagcccgcgcgcgaagcggcgaagaagatctgcgtcgcgcgctat
ctggcgttcggctgcgaaggccaggcggcgaagatcaagccggtgccgctcgagaagatc
gccgagaagtacaaggcaggcgacctcgcgcaagtggtgcgttga

DBGET integrated database retrieval system