KEGG   Burkholderia thailandensis 2002721723: BTQ_910Help
Entry
BTQ_910           CDS       T03111                                 

Definition
(GenBank) transcriptional regulatory, C terminal family protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTQ_910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:btq02022]
    BTQ_910
Two-component system [BR:btq02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BTQ_910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C B12-binding FleQ
Motif
Other DBs
NCBI-ProteinID: AHI73467
Position
1:1040108..1040833
Genome map
AA seq 241 aa AA seqDB search
MTTQILIVDDDQELRDLLRDYLVRQGIEVSVLHDAASLEKRLERERPDLIVLDLMMPGVD
GLTALRQLRAAGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARAQAVLRR
RRTTPSAAAPEQREPYAFGRFVLDFQSRTLSVDSKPATLSSSEFALLKIFVNHALRTLTR
ERLLELLHGPEYDGTDRGIDVQVWRLRRILETDPSTPRFIQTVRGRGYVFVPNGEAHAQT
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactactcagatcctcatcgtcgacgacgaccaagaactgcgcgatctgctgcgcgat
tacctcgtgcggcagggcatcgaggtatcggtgctgcacgacgccgcgtcgctcgagaag
cgcctcgagcgcgagcgccccgatctcatcgtgctcgatctgatgatgccgggcgtcgac
ggcctcaccgcgctgcgccagttgcgcgcggcgggcgacgacattccggtgatcatgctg
accgcgcgcgcggacgacgtcgaccggatcgtcggcctcgagctcggcgcggacgattac
ctcggcaagccgttcaacccgcgcgagctgctcgcgcgcgcgcaggcggtgctgcgccgc
cgccgcacgacgccgtcggcggcggcgcccgagcagcgtgagccgtacgcgttcggccgc
ttcgtgctggacttccagtcgcgcacgctgtcggtcgacagcaagccggcgacgctgtcg
agcagcgaattcgcgctcttgaagatcttcgtcaaccatgcgctgcgcacgctgacccgc
gagcgcctgctcgagttgctgcacggcccggagtacgacggcaccgaccgcgggatcgac
gtgcaggtctggcgcctgcgccggattctcgaaaccgatccgtcgacgccgcgtttcatc
cagacggtgcgcgggcgcggctacgtgttcgtgccgaacggcgaggctcatgcgcaaacc
cattga

DBGET integrated database retrieval system