KEGG   Bartonella tribocorum CIP 105476: BT_1167Help
Entry
BT_1167           CDS       T00636                                 

Gene name
metS
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
btr  Bartonella tribocorum CIP 105476
Pathway
btr00450  Selenocompound metabolism
btr00970  Aminoacyl-tRNA biosynthesis
btr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BT_1167 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BT_1167 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btr01007]
    BT_1167 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btr03016]
    BT_1167 (metS)
Enzymes [BR:btr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BT_1167 (metS)
Amino acid related enzymes [BR:btr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BT_1167 (metS)
Transfer RNA biogenesis [BR:btr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BT_1167 (metS)
 Prokaryotic type
   Other AARSs
    BT_1167 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: CAK01538
UniProt: A9IUC2
Position
1241367..1242926
Genome map
AA seq 519 aa AA seqDB search
MRDTYYITTPIFYPNGHPHIGHAYSAIASDVLARFQRLNGKKVFFLSGTDEHGLKMQQTA
AALDMTPQQLADRNSAVFQKMLAVLNCSNDDFIRTTEERHYQACQEIWKKMEENGDIYLG
RYTGWYSVRQEAYYEEKDTEVGPDNIRREKELGSPVEWNEEESYFFRLSRYEKALLEYYE
KHPDFIAPLERRNEIISFIKSGLKDISISRASFNWGVAVPENPKHVMYVWVDALTNYLSA
IDFFNKNSKKRNFWPANTHIIGKDIIRFHAVYWPAFLMSAGIELPKNIFAHGFLLNRGAK
MSKSVGNVVDPFEMIDHYGLDQVRYFLLREVPFGQDGSYNHESLVNRINADLANDLGNLA
QRSLSMIAKNCDAKVPKPAAFLVQDKQLLEQSLQVLETVHQAMSFHSMHLALSAIFSTVA
DANRYFANEQPWSLRKSDPERFSTVLYITVEILRRIGIMLLPFIPQSAAKLLDSLAVAED
DRLLYHIAHAKIQEGLDLPPPEPIFPRYILKKEDSHHAY
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacacatattacataacaactcctattttttatcctaatggtcatccgcatatt
ggacatgcctatagtgccattgcaagtgatgtcttagcccgctttcagcgattaaacgga
aaaaaggtattttttctttctggtacagatgagcatggtttaaagatgcaacaaactgca
gcagcattggacatgacacctcagcaacttgcagatcgtaatagtgcagtatttcaaaaa
atgcttgcggtattaaattgttctaacgatgatttcatccgtacaacagaagaacgccat
tatcaagcctgtcaagaaatttggaaaaagatggaagaaaatggcgatatttatctcggc
cgttatacgggttggtattcggttcgccaagaagcctattatgaagagaaagatacagaa
gttggaccagataatatccgtcgcgaaaaagaattaggttctcccgttgaatggaatgag
gaagaaagttatttttttagactttctcgttatgaaaaggctcttcttgaatattatgaa
aagcatcctgattttattgctccccttgagcggcgtaatgaaattataagttttatcaaa
tcaggtttaaaagatatttctatttcacgggcaagttttaattggggagttgctgttcct
gaaaatcccaaacacgtgatgtatgtttgggttgatgcgcttacaaattatctatcagca
attgatttttttaataaaaattcaaaaaaacgtaatttttggcctgcaaatacgcatatc
attggtaaggatattattcgttttcatgccgtctattggccggcatttttaatgtctgcg
ggaattgaattacctaaaaatatttttgcacatggttttttacttaatcgtggtgccaaa
atgtcaaaatctgttggaaatgtcgttgatccttttgaaatgattgatcattatggtctt
gatcaggttcgttattttcttctccgtgaagtcccctttggacaagatggtagttataac
catgaaagccttgtgaatcgtattaacgccgatcttgctaacgatcttggaaatttagca
cagcgttctttatctatgattgctaaaaattgtgatgcaaaggttcctaagcccgccgca
tttttagttcaagataaacagcttttagaacaatctcttcaagtgcttgaaacggtacat
caagcgatgtcttttcatagtatgcacttagctctatcagctattttttcaactgtagca
gatgccaatcgctattttgccaacgaacaaccttggagtttacggaaaagtgatccagag
cgattttctacagttctttatataactgtagaaatcttgcgacgaataggaattatgctt
ttgcctttcatcccccaatcagcagcaaagcttcttgatagccttgcggttgctgaagat
gatcggttgttgtatcatatagctcatgcaaaaattcaagaaggacttgatcttccacca
ccagaaccgatttttcctcgttatatcttgaagaaagaagattctcatcatgcttattga

DBGET integrated database retrieval system