KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-190: F544_12620Help
Entry
F544_12620        CDS       T03019                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase class 2
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
btra  Bibersteinia trehalosi USDA-ARS-USMARC-190
Pathway
btra00010  Glycolysis / Gluconeogenesis
btra00030  Pentose phosphate pathway
btra00051  Fructose and mannose metabolism
btra00680  Methane metabolism
btra01100  Metabolic pathways
btra01110  Biosynthesis of secondary metabolites
btra01120  Microbial metabolism in diverse environments
btra01130  Biosynthesis of antibiotics
btra01200  Carbon metabolism
Module
btra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F544_12620
   00030 Pentose phosphate pathway
    F544_12620
   00051 Fructose and mannose metabolism
    F544_12620
  09102 Energy metabolism
   00680 Methane metabolism
    F544_12620
Enzymes [BR:btra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     F544_12620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX Inositol_P
Motif
Other DBs
NCBI-ProteinID: AHG86490
UniProt: W0R857
Position
complement(1381204..1382223)
Genome map
AA seq 339 aa AA seqDB search
MKRSLSIEFSRVTEAAALAAYAWLGRGNKNAADDAAVKAMRYLLNQLDIRGEVVIGEGEI
DQAPMLYIGEKIGKHGANDEEITIAVDPIDGTRMTAMGQSNALSVLAAGGKGTLLQAPDM
YMEKLVVGSDCKGMIDLNLSIEQNLRRIASKKGKLLSQLTVAVLDKPRHQAVISEMQDLG
IRVMAIPDGDVAAAIQCCLPEADLDALYGIGGAPEGVIAAAGVRALGGDMQARLVPRHQV
KGSTPENFAAAEKEIARCNELNVPVNEVLKLEELVRDDNLVFSATGITSGALLSGVQRKG
NLATTETLLIRGRSRTIRKIQSSHYIDRKDDDLLRLMNV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatccctttctatcgaattttctcgtgtcactgaagctgccgctttggcggct
tatgcttggttaggtcgtggtaataaaaatgcagccgacgatgctgcagtaaaagcgatg
cgttatttgttaaatcagcttgatatacggggtgaggttgtcattggtgagggggagata
gatcaagctccaatgctctatattggcgaaaaaattggtaaacatggggcaaatgatgaa
gagattaccattgcagttgatccgattgatggcacacggatgactgcaatggggcaaagt
aatgcattatcagtgcttgcggcaggcggaaaaggtactttattacaagcgcccgatatg
tatatggaaaaattagttgtaggcagtgattgtaaagggatgatcgatttaaatttgtcg
attgaacaaaatttgcgccgcattgcttctaaaaaagggaaactactttcacaattaacc
gttgccgtattggataagccgcgccatcaagctgtaattagtgaaatgcaagatttaggt
atccgtgtgatggctattcctgatggcgatgtagctgctgcaatccaatgctgcttgcca
gaagcagatttagacgcattatatggtattggtggtgcgcctgaaggcgtgatcgctgct
gcaggcgtgagagcattaggtggtgatatgcaagctcgtcttgtacctcgccatcaagtt
aagggcagtacacctgaaaattttgccgcagcagaaaaagagattgcacgttgcaatgaa
ttaaatgtaccagtcaatgaagtattgaaattagaagaacttgtgcgtgatgataatcta
gttttttcagcaacggggattacttcaggagcattattaagcggtgtccaacgtaaaggt
aatttggcgacaacggaaacattattaattcgtggacgttctcgtacgattcgtaaaatc
caatcttcacactatattgatcgtaaagatgatgatttattgcgcttaatgaatgtataa

DBGET integrated database retrieval system