KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-190: F544_8950Help
Entry
F544_8950         CDS       T03019                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btra  Bibersteinia trehalosi USDA-ARS-USMARC-190
Pathway
btra00071  Fatty acid degradation
btra00072  Synthesis and degradation of ketone bodies
btra00280  Valine, leucine and isoleucine degradation
btra00310  Lysine degradation
btra00362  Benzoate degradation
btra00380  Tryptophan metabolism
btra00620  Pyruvate metabolism
btra00630  Glyoxylate and dicarboxylate metabolism
btra00640  Propanoate metabolism
btra00650  Butanoate metabolism
btra00900  Terpenoid backbone biosynthesis
btra01100  Metabolic pathways
btra01110  Biosynthesis of secondary metabolites
btra01120  Microbial metabolism in diverse environments
btra01130  Biosynthesis of antibiotics
btra01200  Carbon metabolism
btra01212  Fatty acid metabolism
btra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F544_8950
   00630 Glyoxylate and dicarboxylate metabolism
    F544_8950
   00640 Propanoate metabolism
    F544_8950
   00650 Butanoate metabolism
    F544_8950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    F544_8950
   00072 Synthesis and degradation of ketone bodies
    F544_8950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F544_8950
   00310 Lysine degradation
    F544_8950
   00380 Tryptophan metabolism
    F544_8950
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F544_8950
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F544_8950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F544_8950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btra04147]
    F544_8950
Enzymes [BR:btra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F544_8950
Exosome [BR:btra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F544_8950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C SpoVAD Ketoacyl-synt_C ZoocinA_TRD
Motif
Other DBs
NCBI-ProteinID: AHG86124
UniProt: W0R4P1
Position
954473..955654
Genome map
AA seq 393 aa AA seqDB search
MKNIVIASAVRTAIGSFGGSLAGVSAVELGTTVIKSAIERAGLDMTKVDEVIMGNVLQAG
LGQNPARQALLRAGIAQEVPAYTVNKVCGSGLKAVALAAQAIKAGDANIIIAGGMENMSQ
APYLLDSKSRWGYRLGDGKVQDVILSDGLMCAENHYHMGITAENVAKKYGITRQMQDELA
LSSQQKATAAIQSGAFKNEIIPMNVKIKRKEVVFDTDEFVKQDSTLEGLSSLRTAFDKEG
TVTAGNASGINDGAAALVVVEEETAKALGLNILARIKGYASGGVAPDIMGMGPVPATQNA
LKKAGLTLNDIDLIEANEAFAAQFLAVGKELGFNPEKVNVNGGAVALGHPIGASGARILV
TLLHAMHARDKQFGLATLCIGGGQGIAMIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagttattgcaagtgcggtgcgcaccgcaatcggcagtttcggtggttct
ttagcaggggtttcggcagtggaactcggcacaacagtaatcaaatctgcgattgagaga
gccggtttagacatgactaaagtagatgaagtgattatggggaatgtgcttcaggccgga
cttgggcaaaaccctgcccgccaagcgttattacgcgcaggtattgcccaagaagtcccc
gcttatacagtaaacaaagtatgtggttcaggtttaaaggctgtggcacttgctgctcaa
gcaattaaagccggtgatgcaaatatcatcatcgctggcggtatggaaaatatgagccaa
gcaccgtacttgttagattctaagtcacgctggggctatcgtttaggcgatggcaaagta
caagatgtgattttatccgatggcttaatgtgtgcagaaaatcactaccatatggggatt
acggcagaaaatgttgccaaaaaatatggtattacccgccaaatgcaggatgaattggca
ctttcctctcagcaaaaagccactgctgccattcaatcaggtgcattcaaaaatgaaatc
ataccaatgaatgtaaaaattaaacgcaaggaagtggtttttgataccgatgagtttgta
aaacaagattcaactcttgaaggtttatcttcacttcgtactgcgtttgataaagaagga
acagttaccgcagggaatgcttcaggtattaacgatggcgctgctgcattagtggtggtc
gaagaagaaacagcaaaagcattgggattaaacattcttgcgcgtattaaaggctatgca
agtggtggggttgcgccagatattatgggcatggggcctgttcctgcaacacaaaatgcg
ctgaaaaaagcaggcttaaccttaaacgacattgatctcattgaagctaatgaagcattt
gcggcacagttcttagcggtgggtaaagagttaggttttaaccctgaaaaagtcaatgta
aacggtggtgcagtagctctaggtcaccctatcggtgcaagtggtgcgcgcatcttagtc
actttattacacgcaatgcatgcccgtgataaacaattcggtttagcaacgctttgtatc
ggtggtggacaaggcattgccatgatcgttgaacgtatttaa

DBGET integrated database retrieval system